DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and mca-2

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_500161.1 Gene:mca-2 / 177004 WormBaseID:WBGene00019875 Length:1158 Species:Caenorhabditis elegans


Alignment Length:213 Identity:58/213 - (27%)
Similarity:89/213 - (41%) Gaps:27/213 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LCARLEANVSQGL---TSEAAGRKLARNGKNVLPLPTKLELR-PWIFLKSCFSILGIIILLSSIA 113
            ||.:|:.:...||   |.|...|:.|.....:.|.|:|...| .|..|:   .|..:|:|::::.
 Worm    39 LCRKLKTDPINGLPNDTKELEHRRTAFGKNEIPPAPSKSFFRLAWEALQ---DITLVILLVAALV 100

  Fly   114 SFAM-YYLFATKTPDNGKVDPEF-LVAGIILLVTFFLAGLTVQMQGDDDEDMLIAFDELMPMYCT 176
            |..: :|....:...|...:.|. .:.|:.:||...:..|...:.....|..   |..|.....|
 Worm   101 SLGLSFYKPPAEHASNDSSESEAGWIEGVAILVAVLVVVLVTALNDWTKEKQ---FRGLQSKIET 162

  Fly   177 -----VIRDGEKEVIRTQDLVPGDTLPIKYGQRLPADMRFFSTTGLELNNVALTGHS----KPMH 232
                 |||.||...|...:||.||...:|||..||||.....:..|:::..:|||.|    |...
 Worm   163 EHKFSVIRGGEPLDIVVNELVVGDIARVKYGDLLPADGLLIQSNDLKIDESSLTGESDLIRKSEE 227

  Fly   233 ITPL------ANEGRQRY 244
            ..|:      |.||..|:
 Worm   228 FDPVLLSGTHAMEGSGRF 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 19/67 (28%)
E1-E2_ATPase 140..>230 CDD:278548 29/98 (30%)
mca-2NP_500161.1 ATPase-IIB_Ca 5..1026 CDD:273668 58/213 (27%)
Cation_ATPase_N 35..101 CDD:279080 18/64 (28%)
E1-E2_ATPase 168..413 CDD:278548 28/78 (36%)
Cation_ATPase 475..564 CDD:289987
HAD <648..767 CDD:289480
Cation_ATPase_C 841..1020 CDD:279079
ATP_Ca_trans_C 1073..>1096 CDD:289209
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156291
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.