DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and Atp12a

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_598201.2 Gene:Atp12a / 171028 RGDID:620569 Length:1036 Species:Rattus norvegicus


Alignment Length:236 Identity:76/236 - (32%)
Similarity:114/236 - (48%) Gaps:30/236 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KKEERESLQQTENELWLEYFSPYLHIWPFHELCARLEANVSQGLTSEAAGRKLARNGKNVLPLPT 86
            |..|:|.|::   ||.|:.     |.....||..:...|:.|||:|..|...|||:|.|.|..|.
  Rat    41 KSHEKEELKK---ELDLDD-----HRLSNTELEQKYGTNIIQGLSSVRATELLARDGPNTLTPPK 97

  Fly    87 KLELRPWI--FLKSC---FSILGIIILLSSIASFAMYYLFATKTPDNGKVDPEFLVAGIILLVTF 146
            :   .|.|  |||..   ||||..|.......:|.:.|:..:.:.||       :..|.||::..
  Rat    98 Q---TPEIIKFLKQMVGGFSILLWIGAALCWIAFVIQYVNNSASLDN-------VYLGAILVLVV 152

  Fly   147 FLAGLTVQMQGDDDEDMLIAFDELMPMYCTVIRDGEKEVIRTQDLVPGDTLPIKYGQRLPADMRF 211
            .|.|:....|.....:::.:|.:::|....||||.||:||..:.||.||.:.||.|.::|||:|.
  Rat   153 ILTGIFAYYQEAKSTNIMASFSKMIPQQALVIRDAEKKVISAEQLVVGDVVEIKGGDQIPADIRL 217

  Fly   212 FSTTGLELNNVALTGHSKPM-------HITPLANEGRQRYS 245
            ..:.|.:::|.:|||.|:|.       |..||..:....||
  Rat   218 VFSQGCKVDNSSLTGESEPQARSTEFTHENPLETKNIGFYS 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 27/75 (36%)
E1-E2_ATPase 140..>230 CDD:278548 32/89 (36%)
Atp12aNP_598201.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50 4/8 (50%)
ATPase-IIC_X-K 40..1036 CDD:273445 76/236 (32%)
Cation_ATPase_N 53..124 CDD:214842 27/78 (35%)
E1-E2_ATPase 146..377 CDD:278548 38/113 (34%)
Cation_ATPase 439..533 CDD:289987
HAD <613..738 CDD:289480
Cation_ATPase_C 811..1021 CDD:279079
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334720
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.