DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and Atp2c1

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_038936656.1 Gene:Atp2c1 / 170699 RGDID:621311 Length:983 Species:Rattus norvegicus


Alignment Length:231 Identity:61/231 - (26%)
Similarity:97/231 - (41%) Gaps:26/231 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RRKKKEER----ESLQQTENELWLEYF-SPYLHIWPFHELCARLEANVSQGLTSEAAGRKLARNG 78
            |.:|.||:    :.:...|||..:... |.........|:...|:|::..||.......:.|.:|
  Rat    29 RNQKAEEQVARFQKIPNVENETMIPVLTSKRASELAVSEVAGLLQADLQNGLNKSEVSHRRAFHG 93

  Fly    79 KNVLPLPTKLELRPWIFLKSCFSILGIIILLSSIASFAMYYLFATKTPDNGKVDPEFLVAGIILL 143
            .|...:.....|  |....|.|....|::||:|.....:...|.         |...:...|:::
  Rat    94 WNEFDISEDEPL--WKKYISQFKNPLIMLLLASAVISVLMRQFD---------DAVSITVAILIV 147

  Fly   144 VTFFLAGLTVQMQGDDDEDMLIAFDELMPMYCTVIRDGEKEVIRTQDLVPGDTLPIKYGQRLPAD 208
            ||      ...:|....|..|....:|:|..|..:|:|:.|....:|||||||:.:..|.|:|||
  Rat   148 VT------VAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPAD 206

  Fly   209 MRFFSTTGLELNNVALTGHSKP-MHIT---PLANEG 240
            :|.|....|.::..:|||.:.| ..:|   |.|..|
  Rat   207 LRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNG 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 16/70 (23%)
E1-E2_ATPase 140..>230 CDD:278548 30/89 (34%)
Atp2c1XP_038936656.1 P-type_ATPase_SPCA 88..930 CDD:319779 48/172 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334714
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.