DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and Atp7a

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001103227.1 Gene:Atp7a / 11977 MGIID:99400 Length:1492 Species:Mus musculus


Alignment Length:291 Identity:52/291 - (17%)
Similarity:96/291 - (32%) Gaps:111/291 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KRISKWRGRWCRSRRKKKEERESLQQTENELWLEYFSP------YLHIWPFHELCARLEANVSQG 64
            :.|.:|||.:..|                   |.:..|      |:.:...|  .|.|..|  |.
Mouse   637 REIKQWRGSFLVS-------------------LFFCIPVMGLMVYMMVMDHH--LATLHHN--QN 678

  Fly    65 LTSEA-----AGRKLARN---GKNVLPLPTKLELRP------WIF-------LKSCFSILGIIIL 108
            :::|.     :...|.|.   |.:::.|.:.|...|      |.|       ||...:.:.::|:
Mouse   679 MSNEEMINMHSAMFLERQILPGLSIMNLLSLLLCLPVQFCGGWYFYIQAYKALKHKTANMDVLIV 743

  Fly   109 LSSIASFA------MYYLFATKTPDNGKVDPEFLVAGIILLVTFFLAGLTVQMQGDDDEDMLIAF 167
            |::..:||      :..:|     :..||:|          :|||           |...||..|
Mouse   744 LATTIAFAYSLVILLVAMF-----ERAKVNP----------ITFF-----------DTPPMLFVF 782

  Fly   168 ----------------------DELMPMYCTVIRDGEKEVIRTQDLVP------GDTLPIKYGQR 204
                                  ..|.....|::....:.::.:::.|.      ||.:.:..|.:
Mouse   783 IALGRWLEHIAKGKTSEALAKLISLQATEATIVTLNSENLLLSEEQVDVELVQRGDIIKVVPGGK 847

  Fly   205 LPADMRFFSTTGLELNNVALTGHSKPMHITP 235
            .|.|.|......: ::...:||.:.|:...|
Mouse   848 FPVDGRVIEGHSM-VDESLITGEAMPVAKKP 877

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 20/97 (21%)
E1-E2_ATPase 140..>230 CDD:278548 18/117 (15%)
Atp7aNP_001103227.1 HMA 11..73 CDD:238219
HMA 174..236 CDD:238219
HMA 280..337 CDD:238219
HMA 380..443 CDD:238219
HMA 484..545 CDD:238219
HMA 559..622 CDD:238219
P-type_ATPase_Cu-like 646..1380 CDD:319783 48/282 (17%)
Endocytosis signal. /evidence=ECO:0000269|PubMed:27337370 1459..1460
PDZD11-binding. /evidence=ECO:0000250 1478..1492
Endocytosis signal. /evidence=ECO:0000269|PubMed:27337370 1479..1480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831023
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.