DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and Atp4a

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001277556.1 Gene:Atp4a / 11944 MGIID:88113 Length:1034 Species:Mus musculus


Alignment Length:223 Identity:62/223 - (27%)
Similarity:103/223 - (46%) Gaps:19/223 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KKKEERESLQQTENELWLEYFSPYLHIWPFHELCARLEANVSQGLTSEAAGRKLARNGKNVLPLP 85
            ||||:.|:::: |.|:       ..|.....||..:.:.:.::||.:..|...|.|:|.|.|..|
Mouse    37 KKKEKLENMKK-EMEI-------NDHQLSVSELEQKYQTSATKGLKASLAAELLLRDGPNALRPP 93

  Fly    86 TKLELRPWIFLKSCFSILGIIILLSSIASFAMYYLFATKTPDNGKVDPEFLVAGIILLVTFFLAG 150
            ....    .::|....:.|.:..|..:|:......||.:..:......:.|...:.|:....:.|
Mouse    94 RGTP----EYVKFARQLAGGLQCLMWVAAAICLIAFAIQASEGDLTTDDNLYLAVALIAVVVVTG 154

  Fly   151 LTVQMQGDDDEDMLIAFDELMPMYCTVIRDGEKEVIRTQDLVPGDTLPIKYGQRLPADMRFFSTT 215
            .....|.....:::.:|..|:|...||||||:|..|....||.||.:.:|.|.|:|||:|..|..
Mouse   155 CFGYYQEFKSTNIIASFKNLVPQQATVIRDGDKFQINADQLVVGDLVEMKGGDRVPADIRILSAQ 219

  Fly   216 GLELNNVALTGHSKPM-------HITPL 236
            |.:::|.:|||.|:|.       |.:||
Mouse   220 GCKVDNSSLTGESEPQTRSPECTHESPL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 16/70 (23%)
E1-E2_ATPase 140..>230 CDD:278548 32/89 (36%)
Atp4aNP_001277556.1 H-K_ATPase_N 2..>27 CDD:286172
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 14..40 2/2 (100%)
ATPase-IIC_X-K 42..1034 CDD:273445 58/218 (27%)
Cation_ATPase_N 50..124 CDD:214842 17/84 (20%)
E1-E2_ATPase 156..375 CDD:278548 34/92 (37%)
Cation_ATPase 437..531 CDD:289987
COG4087 616..>742 CDD:226572
Cation_ATPase_C 809..1018 CDD:279079
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831019
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.