DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and Atp2a2

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001103610.1 Gene:Atp2a2 / 11938 MGIID:88110 Length:1044 Species:Mus musculus


Alignment Length:200 Identity:58/200 - (28%)
Similarity:93/200 - (46%) Gaps:19/200 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 HIWPFHELCARLEANVSQGLTSEAAGRKLARNGKNVLPL---PTKLELRPWIFLKSCFSILGIII 107
            |.....|:......|.|.||:.|...:...|.|.|.||.   .|.|||    .::....:|..|:
Mouse     5 HTKTVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPAEEGKTLLEL----VIEQFEDLLVRIL 65

  Fly   108 LLSSIASFAMYYLFATKTPDNGKVDPEFLVAGIILLVTFFLAGLTVQMQGDDDEDMLIAFDELMP 172
            ||::..||.:.:....:......|:| |::  :::||...:.|:   .|..:.|:.:.|..|..|
Mouse    66 LLAACISFVLAWFEEGEETITAFVEP-FVI--LLILVANAIVGV---WQERNAENAIEALKEYEP 124

  Fly   173 MYCTVIRDGEKEV--IRTQDLVPGDTLPIKYGQRLPADMRFFS--TTGLELNNVALTGHSKPM-- 231
            ....|.|...|.|  |:.:|:||||.:.|..|.::|||:|..|  :|.|.::...|||.|..:  
Mouse   125 EMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIK 189

  Fly   232 HITPL 236
            |..|:
Mouse   190 HTDPV 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 22/73 (30%)
E1-E2_ATPase 140..>230 CDD:278548 31/93 (33%)
Atp2a2NP_001103610.1 Cation_ATPase_N 4..72 CDD:279080 20/70 (29%)
ATPase-IIA1_Ca 53..988 CDD:273452 42/147 (29%)
E1-E2_ATPase 93..340 CDD:278548 33/106 (31%)
Cation_ATPase 419..527 CDD:289987
Interaction with HAX1. /evidence=ECO:0000250 575..594
HAD <605..711 CDD:289480
Cation_ATPase_C 783..986 CDD:279079
Interaction with PLN. /evidence=ECO:0000250|UniProtKB:P04191 787..807
Interaction with TMEM64 and PDIA3. /evidence=ECO:0000269|PubMed:23395171 788..1044
Interaction with PLN. /evidence=ECO:0000250|UniProtKB:P04191 931..942
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831015
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.