DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and Atp1a1

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_659149.1 Gene:Atp1a1 / 11928 MGIID:88105 Length:1023 Species:Mus musculus


Alignment Length:233 Identity:66/233 - (28%)
Similarity:113/233 - (48%) Gaps:25/233 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RGRWCRSRRKKKEERESLQQTENELWLEYFSPYLHIWPFHELCARLEANVSQGLTSEAAGRKLAR 76
            :|:..:..|...|.::.:...:::|.|:            ||..:...::|:|||...|...|||
Mouse    22 KGKKAKKERDMDELKKEVSMDDHKLSLD------------ELHRKYGTDLSRGLTPARAAEILAR 74

  Fly    77 NGKNVL-PLPTKLELRPWI-FLKSCFSILGIIILLSSIASFAMYYLFAT--KTPDNGKVDPEFLV 137
            :|.|.| |.||..|   |: |.:..|....:::.:.:|..|..|.:.:.  :.|.|     :.|.
Mouse    75 DGPNALTPPPTTPE---WVKFCRQLFGGFSMLLWIGAILCFLAYGIRSATEEEPPN-----DDLY 131

  Fly   138 AGIILLVTFFLAGLTVQMQGDDDEDMLIAFDELMPMYCTVIRDGEKEVIRTQDLVPGDTLPIKYG 202
            .|::|.....:.|.....|......::.:|..::|....|||:|||..|..:|:|.||.:.:|.|
Mouse   132 LGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSINAEDVVVGDLVEVKGG 196

  Fly   203 QRLPADMRFFSTTGLELNNVALTGHSKPMHITP-LANE 239
            .|:|||:|..|..|.:::|.:|||.|:|...:| ..||
Mouse   197 DRIPADLRIISANGCKVDNSSLTGESEPQTRSPDFTNE 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 22/72 (31%)
E1-E2_ATPase 140..>230 CDD:278548 30/89 (34%)
Atp1a1NP_659149.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39 3/16 (19%)
ATPase-IIC_X-K 29..1023 CDD:273445 65/226 (29%)
Cation_ATPase_N 40..114 CDD:214842 24/88 (27%)
Phosphoinositide-3 kinase binding. /evidence=ECO:0000250 82..84 1/1 (100%)
E1-E2_ATPase 134..365 CDD:278548 34/101 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..235 8/19 (42%)
Cation_ATPase 427..521 CDD:289987
COG4087 606..>732 CDD:226572
Cation_ATPase_C 799..1008 CDD:279079
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S851
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.