DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45122 and smkr1

DIOPT Version :9

Sequence 1:NP_001287309.1 Gene:CG45122 / 19835488 FlyBaseID:FBgn0266615 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_001289402.1 Gene:smkr1 / 103910385 -ID:- Length:91 Species:Danio rerio


Alignment Length:84 Identity:37/84 - (44%)
Similarity:46/84 - (54%) Gaps:11/84 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KKKRNSKDSTSSNAGSGEGEEKKKKEGGKKKGGVGKS--IGCDIFNDAAMENAYYVCHNVQDVLK 68
            ||.|    |.|:.|.|    :.|:|...||:....|:  ...||.:.|||||.||:.||..|.|:
Zfish    13 KKSR----SQSARAAS----KSKRKRSSKKRSVSAKASKTDVDILSPAAMENVYYISHNAVDCLE 69

  Fly    69 SRGFAWPDGQKKK-KKGKR 86
            .|||.||...||| ||||:
Zfish    70 FRGFGWPGATKKKGKKGKK 88



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10614
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5401
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0015091
OrthoInspector 1 1.000 - - oto39624
orthoMCL 1 0.900 - - OOG6_112552
Panther 1 1.100 - - LDO PTHR37932
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11926
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.960

Return to query results.
Submit another query.