DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45154 and CG45487

DIOPT Version :10

Sequence 1:NP_001285514.1 Gene:CG45154 / 19835236 FlyBaseID:FBgn0266647 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001285468.1 Gene:CG45487 / 19834759 FlyBaseID:FBgn0267043 Length:90 Species:Drosophila melanogaster


Alignment Length:90 Identity:66/90 - (73%)
Similarity:74/90 - (82%) Gaps:1/90 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQQKSDISHLVIQCIDAMGGFASKSVIPKALSTATDRKILNIGSRIEDALDKLIVQGVIRKHNG 65
            |||:||:||||||||||||.|||||.||.||:|||||:|...:|.||:||||.|||.||||.||.
  Fly     1 MSQKKSNISHLVIQCIDAMDGFASKEVILKAVSTATDKKFWKMGRRIDDALDTLIVDGVIRTHND 65

  Fly    66 NYYLNMQERTASDSHCHSDSE-DSD 89
            ||||||.|.|||.|||:|.|: |||
  Fly    66 NYYLNMLEETASASHCNSGSDSDSD 90

Return to query results.
Submit another query.