DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45493 and CG45486

DIOPT Version :10

Sequence 1:NP_001285474.1 Gene:CG45493 / 19835131 FlyBaseID:FBgn0267049 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001285467.1 Gene:CG45486 / 19836213 FlyBaseID:FBgn0267042 Length:90 Species:Drosophila melanogaster


Alignment Length:90 Identity:85/90 - (94%)
Similarity:86/90 - (95%) Gaps:0/90 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQKKSNISHLVIQCIDAMGGFASKEVILKAVSTATDKKFWKMGRRIDDALDTLIVDGVIRTHND 65
            |||||||||||||||||||.||||||:||||||.|||||||||||||||||||||||||||.|||
  Fly     1 MSQKKSNISHLVIQCIDAMDGFASKEMILKAVSKATDKKFWKMGRRIDDALDTLIVDGVIRKHND 65

  Fly    66 NYYLNMLEETASASHCNSGSDSDSD 90
            ||||||||||||.||||||||||||
  Fly    66 NYYLNMLEETASDSHCNSGSDSDSD 90

Return to query results.
Submit another query.