DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45071 and CG11504

DIOPT Version :9

Sequence 1:NP_730024.1 Gene:CG45071 / 19834908 FlyBaseID:FBgn0266441 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_651758.1 Gene:CG11504 / 43557 FlyBaseID:FBgn0039733 Length:410 Species:Drosophila melanogaster


Alignment Length:388 Identity:81/388 - (20%)
Similarity:126/388 - (32%) Gaps:153/388 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QFIHDIEERPAIWN------RNFHCNKAFLEQMWDELSGAHKLPKIVLKAKWKGLRDNFRVEYKR 72
            |.|.:...|..:|:      |.....:..|.::...|.|  .:|...|:.|:..||..:..|..|
  Fly    10 QLISEYRSRRGLWDMTCDEYRKKDVKQRLLNEVSQVLGG--NIPINELEKKFHTLRTQYHREISR 72

  Fly    73 IPRADNGDFMVDPATFESKWLHYYALLFLT------------------------------DH--- 104
            :.|.:         .:.|||..:..|:||:                              ||   
  Fly    73 MKRKE---------PYNSKWFGFKNLVFLSSPYACRSTKGRLKADLQGDERKFVLGEVTADHNSD 128

  Fly   105 ----MRHRLPKNEQDQSFYF-----SQQSEDCEKTVVEPDLTNGLIRRLQDSDEDYDEEEMEADG 160
                ..|....|......|.     |.::::.||.:.|         ..:|.| |.||.|:| :|
  Fly   129 SSTPANHNSNTNANMNEEYLRKNHASSRAQELEKLIEE---------TTKDVD-DIDESELE-EG 182

  Fly   161 E-----ASEATM--------EETMPTP-------PAAHQMNQV---------------STTPL-A 189
            |     |.|.::        |||.|..       ...||.|.|               .|||. :
  Fly   183 EVKPKQAKEMSVRFVSLNEQEETEPLENHHQTLMDLHHQGNAVEAVSFQANESGELHYQTTPTQS 247

  Fly   190 TGALRAQEEAHQHALIKAGLLRAQLMELEKEAED------LSRKPPPPQQMTSPVAPSLQVLVEP 248
            ||:    ...|   ::...:::.|..:.....||      ....|||.::|....:         
  Fly   248 TGS----SSVH---VMPTRIIKIQRRDTSSGQEDSYFEEHTQLHPPPVKRMYYEAS--------- 296

  Fly   249 PAAHCSPPPMVTTTSAQVQQPGSAAVLAPATTTSASSVSSN------GAPMGGKR--SVSPPP 303
            ||:|       .|||          :|:||..:||:..:|:      |..|...|  .|:.||
  Fly   297 PASH-------NTTS----------ILSPALESSANGTASSVLTTSPGITMSNLRLPKVNTPP 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45071NP_730024.1 MADF 14..106 CDD:214738 24/134 (18%)
BESS 384..418 CDD:281011
CG11504NP_651758.1 MADF_DNA_bdg 11..92 CDD:287510 19/91 (21%)
CytochromB561_N 238..>409 CDD:286826 31/138 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.