DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45071 and CG12768

DIOPT Version :9

Sequence 1:NP_730024.1 Gene:CG45071 / 19834908 FlyBaseID:FBgn0266441 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001262229.1 Gene:CG12768 / 40513 FlyBaseID:FBgn0037206 Length:429 Species:Drosophila melanogaster


Alignment Length:387 Identity:86/387 - (22%)
Similarity:146/387 - (37%) Gaps:97/387 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 HDIEER---------PAIWN-RNFHCNKAFLEQ--MWDELSGAHKLPKIVLKAKWKGLRDNFRVE 69
            |:||:|         |.:|: |..|..::...:  .|:||.....:....::..:..||:.||.|
  Fly     6 HNIEKRRLIELVRLNPILWDCRLPHYKRSDKRKAIKWNELGRLFNVNGERVQRTFTSLREIFRRE 70

  Fly    70 YKRIPRADNGDFMVDPATFESKWLHYYALLFLTDHMRHRLP----KNEQDQSFYFSQQSEDCEKT 130
            .       |.:.|:....|:|||.:|.|:.||.:.:|.|..    |:....|...:..|.:....
  Fly    71 L-------NHEKMLGTTRFKSKWEYYDAMAFLKEVIRERKSRERIKHGSLDSAPVATGSSNNNNN 128

  Fly   131 VVEPDLTNGLIRRLQDSDEDYDEEEMEADGEASEATME-ETMPTPPAAHQMN------QVSTTPL 188
            .|..:.:|.     ..|....||.:..|..:.:....: :..|.|.::..:.      .:|..|:
  Fly   129 CVSRNSSNN-----NSSSAALDEYQYFAPSDPNNPNNQPQLQPEPKSSLPVTIPSLSLTLSQLPV 188

  Fly   189 ATGALRAQEEAHQHALIKAGLLR--AQLMELEKEA--EDLSRKPPPPQQMTSPV----------- 238
            |     .|::| ||  ::|..|:  ..|..|:|::  ..|:...|.|...|||.           
  Fly   189 A-----LQQQA-QH--LQALQLQPDVTLTSLQKQSLPTSLTNATPAPLAQTSPAQVLSSSRSCSS 245

  Fly   239 APSLQVLVEP--PAAHCSPPPMVT------------TTSAQVQQPGSAAVLAPATTTSASSVSSN 289
            :||:.:..||  ||..| |..::|            |...|.:|...|.:..|....|:|     
  Fly   246 SPSIYIKDEPCSPAGGC-PEEVMTGNGPEATRKKLATIRPQTKQQLKARLQLPTPKNSSS----- 304

  Fly   290 GAPMGGKRSVSPPPLYNKAHHPLATLAAAHLAAK----DRNED--------FGPTSAVGGNG 339
                   .:.|||.|...|::.|....|..|...    |.::|        .|.:..:|.:|
  Fly   305 -------YATSPPHLIINANNELIDTDAGDLEEDLDDFDEDDDVTGRCSPIVGQSETMGADG 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45071NP_730024.1 MADF 14..106 CDD:214738 26/100 (26%)
BESS 384..418 CDD:281011
CG12768NP_001262229.1 MADF 12..100 CDD:214738 22/94 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.