DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45071 and CG3919

DIOPT Version :9

Sequence 1:NP_730024.1 Gene:CG45071 / 19834908 FlyBaseID:FBgn0266441 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001261840.1 Gene:CG3919 / 39582 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster


Alignment Length:254 Identity:48/254 - (18%)
Similarity:89/254 - (35%) Gaps:83/254 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAPKKSTIVLNVEQFIHDIEERPAIWNR--NFHCNKAFLEQMWDELSGAHKLPKIVLKAKWKGLR 63
            :||..:...:|. :..|.::..|.:::|  :.:..|:.::..|.|:|...:......|.:|:.:|
  Fly     8 IAPPPNVYAINA-KICHLVKLHPCLYDRHDDNYLRKSTVKNAWKEISNEMRNSVKSCKERWRNIR 71

  Fly    64 DNFRVEYKRIPRADNGDFMVDPATFESKWLH-----YY---ALLFLTDHM----------RHRLP 110
            .::....|                     ||     ||   .|.||..|:          |...|
  Fly    72 SSYARSIK---------------------LHHGANTYYLNSELKFLQKHITPGVPVPLRGRRSRP 115

  Fly   111 KNEQDQSFYFSQQSEDCEKTVVE--------PDLTNGLIRRLQDSDEDYDEEEMEA----DGEAS 163
            |.::       :..|...:|.||        |...|....:.:.|.:.....::||    :..:|
  Fly   116 KGQE-------EHDEGDPETPVEAILEMVHSPSFLNSEHAQSRHSTDPASATDVEATQFNNEPSS 173

  Fly   164 EATMEETMPTPPAAHQMNQVSTTPLATGALRAQEEAHQHALIKAG---LLRAQLMELEK 219
            ....|:|:|             ..:.|.:..:::||      |.|   |.|..|:|..|
  Fly   174 IMDFEDTVP-------------AEMRTESDSSEKEA------KVGEITLYRVPLLEFPK 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45071NP_730024.1 MADF 14..106 CDD:214738 19/111 (17%)
BESS 384..418 CDD:281011
CG3919NP_001261840.1 MADF 20..100 CDD:214738 18/100 (18%)
BESS 226..260 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.