DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45071 and CG6683

DIOPT Version :9

Sequence 1:NP_730024.1 Gene:CG45071 / 19834908 FlyBaseID:FBgn0266441 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_648232.1 Gene:CG6683 / 38970 FlyBaseID:FBgn0035902 Length:197 Species:Drosophila melanogaster


Alignment Length:211 Identity:42/211 - (19%)
Similarity:70/211 - (33%) Gaps:49/211 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QFIHDIEERPAIWNRN-----FHCNKAFLEQMWDELSGAHKLPKIVLKAKWKGLRDNFRVEYKRI 73
            :.|..:...|.::.|.     :..:|....::|..::.:.........::|..|....|.|..:.
  Fly     7 RLIELVRANPKLYERELRNAPYEAHKKRHPEIWSSIATSLNSEASACVSRWNHLVAKQRRELAKE 71

  Fly    74 PRADNGDFMVDPATFESKWLHYYALLFLTDHMRHRLPKNEQDQSFYFSQQSEDCEKTVVEPDLTN 138
            .....|          |.|.....|.||   ..|..|.|.::..                 ||:.
  Fly    72 KAGGTG----------SDWSLLPHLKFL---QHHHHPINHRNSG-----------------DLSR 106

  Fly   139 GLIRRLQDSDEDYDEEEMEADGEASEATMEETMPTPPAAHQMNQVSTTPLATGALRAQEEAHQHA 203
            .   .|:.|||..|:|:...:....:..:....|.||.    |....||:      ||.|....|
  Fly   107 S---TLKSSDEVNDDEDPLQEAMDEQLAVAGAAPAPPT----NPAHATPV------AQAEKRIEA 158

  Fly   204 LIKAGLLRAQLMELEK 219
            |:: ||..|..::.||
  Fly   159 LLE-GLGEANRIKAEK 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45071NP_730024.1 MADF 14..106 CDD:214738 15/96 (16%)
BESS 384..418 CDD:281011
CG6683NP_648232.1 MADF 7..94 CDD:214738 16/99 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.