DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45071 and Coop

DIOPT Version :9

Sequence 1:NP_730024.1 Gene:CG45071 / 19834908 FlyBaseID:FBgn0266441 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001260776.1 Gene:Coop / 35677 FlyBaseID:FBgn0263240 Length:358 Species:Drosophila melanogaster


Alignment Length:437 Identity:78/437 - (17%)
Similarity:148/437 - (33%) Gaps:149/437 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VEQFIHDIEERPAIWNRNFHCN---KAFLEQMWDELSGAHKLPKIVLKAKWKGLRDNFRVEYKRI 73
            |::.|..:..||.:|.|| :.|   ::.:..:|.|:.....||..:.:.||..||||||..|   
  Fly    40 VKRLIAAVSRRPMLWLRN-NANGQKRSDITPVWFEVGQDVNLPADICRIKWGHLRDNFRKVY--- 100

  Fly    74 PRADNGDFMVDPATFESKWLHYYALLFLTDHMRHRLPKNEQDQSFYFSQQSEDCEKTVVEPDLTN 138
                                           :|:.| .||...|:.|..     :...:||.:..
  Fly   101 -------------------------------IRNNL-SNETPSSWRFYN-----DMRFMEPAVHE 128

  Fly   139 GLIRRLQDSDEDYDEEEMEADGEASEATMEETMPTPPAAHQMNQVSTTPLATGALRAQEEAHQHA 203
            .::|:.:.|.:.:.......:.........::||.         |:|.|:...:.....|.||  
  Fly   129 NIMRQTRSSSKKHPPGHWTENNNVLGPDKYDSMPI---------VATEPICELSHSYDSELHQ-- 182

  Fly   204 LIKAGLLRAQLMELEKEAEDLSRKPPPPQQMTSPVAPSLQVLVE-------PPAAHCSPPPMVTT 261
                    ....::....||...:||..::..|  .||.:...|       ..||          
  Fly   183 --------PSFSDISSFFEDRDCQPPENKRFKS--EPSQREEDEEDDDDFDEDAA---------- 227

  Fly   262 TSAQVQQPGSAAVLAPA------------------TTTSASSVSSNGAPMGGKRSVSPPPLYNKA 308
            :....::.|:.|..|.:                  |.|.|::.|..|:.:   :|.....:::.:
  Fly   228 SENLEEERGNRADAASSGVFTIEVLDDDDEMEQAVTKTKANNTSHGGSSL---KSEQEAKVFSNS 289

  Fly   309 HHPLATLAAAHLAAKDRNEDFGPTSAVGGNGDHLSFTQHSYANGLIPALKLKRPRLSEDSNFNGS 373
            ..|.|.|...:::......    |...||:                                   
  Fly   290 QSPTADLPFKYISTDVATN----TDPSGGD----------------------------------- 315

  Fly   374 STMDTPLVPEDDDYHYLLSLHPYMKQLTAAQKLRIRTKIQKLIFKEL 420
                   :.::.|..:||||.|::::|.:.::||:|.|:|.::.:||
  Fly   316 -------LQDEADRMFLLSLMPFLQRLDSRRRLRVRQKLQNVLIEEL 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45071NP_730024.1 MADF 14..106 CDD:214738 20/94 (21%)
BESS 384..418 CDD:281011 12/33 (36%)
CoopNP_001260776.1 MADF 42..124 CDD:214738 26/122 (21%)
BESS 320..353 CDD:281011 12/32 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103389at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.