DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45071 and CG10949

DIOPT Version :9

Sequence 1:NP_730024.1 Gene:CG45071 / 19834908 FlyBaseID:FBgn0266441 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster


Alignment Length:328 Identity:68/328 - (20%)
Similarity:113/328 - (34%) Gaps:123/328 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VLNVEQFIHDIEERPAIWNRN---FHCNKAFLEQMWDELSGAHKLPKIVLKAKWKGLRDNFRVEY 70
            :|| ||.|..::..|.:::|:   ...|.|...:.|.|:|....:.:.:...:||.|||.|..|:
  Fly   136 LLN-EQLIELVKSHPVLYDRHKIRVSKNLAAKNEAWREISENLNVSEELCYNRWKKLRDRFGREF 199

  Fly    71 KRIPRADNGDFMVDPATFESKWLHYYALLFLTDHMRHRLP------------------------- 110
            :        ...::.:| ...|.::..||||..|.|..:|                         
  Fly   200 R--------SHQINQST-PITWRYFNDLLFLGRHFRKGVPLVLENIKRRGRPPKAGNPSGKTSKQ 255

  Fly   111 -------KNEQ--DQSFYFSQQSEDCEKTVVEPDLTNGLIRRLQDSDEDYDEE-EMEADGE---- 161
                   ..||  ...:.:|..::|.|                .|.:..|||| |:.::.|    
  Fly   256 PEGMVISSGEQIWGADYPYSTDNDDLE----------------DDLELAYDEEIEILSEAEQATP 304

  Fly   162 ----ASEATMEETMPTPPAAHQMNQVSTTPLATGALRAQEEAH---------------------- 200
                .||||..:.:..|    |..||:||..||    ::|..|                      
  Fly   305 YDFILSEATARQDLEPP----QQLQVTTTTPAT----SEEIIHTIARVNPVVEESSSLPGDSVPS 361

  Fly   201 ---------------QHALIKAGLLRAQL-MELEKEAEDLSRKP-----PPPQQMTSPVAPSLQV 244
                           :..|.::..|:||: .|.|:|.|..|.:|     ...|.:...::||.:.
  Fly   362 AAISDKLLTTVIANMETVLQQSRELQAQIHHEQEQEREQRSTQPANSLLAKAQMLLDGLSPSERA 426

  Fly   245 LVE 247
            ..|
  Fly   427 SAE 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45071NP_730024.1 MADF 14..106 CDD:214738 23/94 (24%)
BESS 384..418 CDD:281011
CG10949NP_001286101.1 MADF 5..91 CDD:214738
MADF 140..226 CDD:214738 23/94 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.