DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45071 and brwl

DIOPT Version :9

Sequence 1:NP_730024.1 Gene:CG45071 / 19834908 FlyBaseID:FBgn0266441 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_609298.1 Gene:brwl / 34275 FlyBaseID:FBgn0032130 Length:435 Species:Drosophila melanogaster


Alignment Length:392 Identity:84/392 - (21%)
Similarity:135/392 - (34%) Gaps:104/392 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QFIHDIEERPAIWNRNF--HCNKAFLEQMWDELSGAHKLPKIVLKAKWKGLRDNFRVEYKRIPRA 76
            :|::.:.....::::..  :.|:...|:.|..:|...:...|..|.:|:    |.|....|..:.
  Fly    60 RFVNLVRTHKCLYDKKVPEYRNRDNQEKAWVLISKETRESVIHCKERWR----NLRACLSRYIKQ 120

  Fly    77 DNGDFMVDPATFESKWLHYYALLFLTDHMRHRLP-----------KNEQDQSFYFSQQSEDCEKT 130
            .:|.        |.:...||    ||:||...||           .|.....:..|||....:..
  Fly   121 QSGS--------EPQHKPYY----LTEHMAFLLPFLKSSRNSLEGNNSLATLYQMSQQHLQHQPF 173

  Fly   131 VVEPDL---------TNGLIRRLQDSDEDYDEEEMEA---DGEASEATMEETMPT-PPAAHQ--- 179
            ::.|.|         .|..|....::::.::.|.||.   ....||...|||:.. .||...   
  Fly   174 LLHPALHATEEHKYCANTSINNNNNNNDVHNGESMEVLEMKYSISEKDDEETIDAFDPAVTNTLG 238

  Fly   180 MNQVSTTPLATGALR-------AQEEAHQHALIKAGLLRAQLMELEKEA--EDLSRKPPPPQQMT 235
            ||:.|:||..:.||:       |:.:......:|..:...||.|...:.  .|.....|||    
  Fly   239 MNRTSSTPTRSSALQGGGGNSPARSDTASADSMKNFIPDVQLAETGSQLIYSDGGHGTPPP---- 299

  Fly   236 SPVAPSLQVLVEPPAAHCSPPPMVTTTSAQVQQPGSAAVL-----APATTTSASSV-----SSNG 290
                     |...|.:|..|..:.........:|||...:     |.:|.|:|.|:     ||..
  Fly   300 ---------LHYHPHSHPHPLTLSMDHHPASYEPGSTKRIKTECEATSTMTNAGSIYGGLSSSEV 355

  Fly   291 APMGGKRSVSPPPLYNKAHHPLATL------------------AAAHLAAKDRNEDFGPTSAVGG 337
            |.|...||:.|         .||||                  ......|:|.:...|.:..|.|
  Fly   356 ADMEFFRSILP---------DLATLTPQQRRKFKIGILELIDDVVTRYPAQDHSNGGGVSGVVNG 411

  Fly   338 NG 339
            :|
  Fly   412 SG 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45071NP_730024.1 MADF 14..106 CDD:214738 18/93 (19%)
BESS 384..418 CDD:281011
brwlNP_609298.1 MADF 60..145 CDD:214738 21/100 (21%)
BESS 356..389 CDD:281011 9/41 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.