DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45071 and CG11723

DIOPT Version :9

Sequence 1:NP_730024.1 Gene:CG45071 / 19834908 FlyBaseID:FBgn0266441 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001259906.1 Gene:CG11723 / 33388 FlyBaseID:FBgn0031391 Length:350 Species:Drosophila melanogaster


Alignment Length:425 Identity:74/425 - (17%)
Similarity:136/425 - (32%) Gaps:170/425 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QFIHDIEERPAIWNRN----FHCNKAFLEQMWDELSGAHKLPKIVLKAKWKGLRDNFRVEYKRIP 74
            :.|.::.:|..:|:.|    :....|.|:  |..::...:....:.|.::||:||::|.|.::|.
  Fly     7 RLIQEVSKRRCLWDTNMSISYRNQDAALQ--WASVAQIMQQDVSICKKRFKGMRDSYRAEVRKIQ 69

  Fly    75 RADNGDFMVDPATFE-SKWLHYYALLFLTDHMRHRLPKNEQDQSFYFSQQSEDCEKTVVEPDLTN 138
            :          ...| |.|.::.:|.|:                           :.:.:|:   
  Fly    70 Q----------KRIEMSHWPYFRSLEFM---------------------------RQIFDPE--- 94

  Fly   139 GLIRRLQDSDEDYDEEEMEADGEASEATMEETMPTPPAAHQMNQVSTTPLATGALRAQEEAHQHA 203
            ||:                              |.||....||  :..|......|..:.|    
  Fly    95 GLV------------------------------PFPPEPFVMN--TEQPEVFEPTRLVDFA---- 123

  Fly   204 LIKAGLLRAQLMELEKEAEDLSRKPPPPQQMTSPVAPSLQVLVEPPAAHCSPPPMVTTTSAQVQQ 268
             |...|.....::.|...:...|:|..||...|                                
  Fly   124 -IDLDLDNDDSVDFEIIEDIFKREPSVPQDSGS-------------------------------- 155

  Fly   269 PGSAAVLAPATTTSASSVSSNGAPMGGKRSVSPPPLYNKAHHPLATLAAAHLAAKDRNEDFGPTS 333
             ...:::.|..:      ||:||              :::...|:.....||   .|::.|.|..
  Fly   156 -DKGSLIKPLDS------SSSGA--------------HRSDQDLSPTLPIHL---PRHQQFLPRP 196

  Fly   334 AVGGNGDHLSFTQHSYANGLIPALKLKRPRLSEDSN----FNG-----SSTMDTPLVPEDDDYHY 389
            .                    |..|..|.|.:..||    .||     |.:...|.:..|.|..:
  Fly   197 P--------------------PPSKRGRRRKTSPSNDVPLLNGYASQASKSTTEPDLKNDSDLSF 241

  Fly   390 LLSLHPYMKQLTAAQKLRIRTKIQKLIFKELYKED 424
            |:|:.|::|.|:|...|:.|.::.:::. ||.:||
  Fly   242 LMSMMPHVKSLSAISNLKFRMEMARVLV-ELREED 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45071NP_730024.1 MADF 14..106 CDD:214738 20/96 (21%)
BESS 384..418 CDD:281011 10/33 (30%)
CG11723NP_001259906.1 MADF 7..91 CDD:214738 20/122 (16%)
BESS 236..270 CDD:281011 10/34 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103389at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.