DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45071 and madf-3

DIOPT Version :9

Sequence 1:NP_730024.1 Gene:CG45071 / 19834908 FlyBaseID:FBgn0266441 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_494766.1 Gene:madf-3 / 186755 WormBaseID:WBGene00019218 Length:312 Species:Caenorhabditis elegans


Alignment Length:126 Identity:33/126 - (26%)
Similarity:50/126 - (39%) Gaps:26/126 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NKAFLEQMWDEL---SGAHKLPKIVLKAKWKGLRDNFRVEYKRIPRADNGDFMVDPATFESKWLH 94
            |..:..::|..|   .|....|: :|.|:||.|||.:..| ||..:..|.         :|.|.:
 Worm    30 NTEYKNRVWQRLVTVLGFDGDPR-MLSARWKQLRDKYGKE-KRKQKYGNE---------KSSWQY 83

  Fly    95 YYALLFLTDHMRHRL---PKNEQDQSFYFSQQSEDCEKTVVEPDLTNGLIRRLQDSDEDYD 152
            :..|.||..||..|.   |..::....:        || :.||.....||..::.....||
 Worm    84 FKHLHFLDPHMTDRAEISPSRKEPTGVH--------EK-IAEPCFGKNLILEVRRHPCLYD 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45071NP_730024.1 MADF 14..106 CDD:214738 22/75 (29%)
BESS 384..418 CDD:281011
madf-3NP_494766.1 MADF 9..94 CDD:214738 21/74 (28%)
MADF 122..212 CDD:214738 4/14 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.