DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45071 and madf-5

DIOPT Version :9

Sequence 1:NP_730024.1 Gene:CG45071 / 19834908 FlyBaseID:FBgn0266441 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_497028.1 Gene:madf-5 / 175118 WormBaseID:WBGene00007242 Length:423 Species:Caenorhabditis elegans


Alignment Length:311 Identity:72/311 - (23%)
Similarity:109/311 - (35%) Gaps:98/311 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DIEERPAIW-----NRNFHCNKAFLEQMWDELSGAH-KLPKIVLK------AKW----------K 60
            |..||..:|     |.:.:|...|.::.|.:|...: |..||.:|      .:|          .
 Worm    31 DTMERQRLWESIAKNIDPNCAAEFAKKRWLQLRDRYRKELKIAIKNGFVTPVRWCYFNQLSWLDP 95

  Fly    61 GLRDNF---RVEYKRIPRADNGDFMVDPATFESKWLHYYALLFLTDHMR---------------- 106
            .|:||.   ..|.|:..::|:.|   :|:.....|..:..|..:.|.|.                
 Worm    96 FLKDNIGQAADEGKKTGKSDSFD---EPSGTPFSWFGFPNLNSIKDEMEDDDSDPALESSVLDRL 157

  Fly   107 -----HRL----PKNEQDQSFYFSQQSEDCEKTVVEPDLTNGLIRRLQDSDEDY---DEEEMEAD 159
                 .||    |:.|.|:|   ..||.|.....|:.|         .|.:||.   ||:|:|.|
 Worm   158 LAQTAQRLDSISPEIENDES---GTQSLDGNLDGVDGD---------GDEEEDLKIKDEDEVEED 210

  Fly   160 G--------EA----SEATMEETMPTPPAAHQMNQVSTTPLATGALRAQEEAHQHALIKAGLLRA 212
            |        ||    .||...::......|.|:.||..||         ::....:||.|...|.
 Worm   211 GPEKVKSQSEAMAMLKEAISAQSQQQTQQAQQVQQVQQTP---------QKPSVESLIAANQARF 266

  Fly   213 QLMELEKEAEDLSRKPPPPQQMTSPVAPSLQVLVEPPAAHCSPPPMVTTTS 263
                    |..|:.:......|.:....|.:..: ||....:|||..:|||
 Worm   267 --------AHHLAAQLTGMSSMLNGARKSEEAAI-PPLRPSTPPPTASTTS 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45071NP_730024.1 MADF 14..106 CDD:214738 25/112 (22%)
BESS 384..418 CDD:281011
madf-5NP_497028.1 MADF 10..98 CDD:214738 14/66 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.