powered by:
Protein Alignment CG45071 and CTPS1
DIOPT Version :9
Sequence 1: | NP_730024.1 |
Gene: | CG45071 / 19834908 |
FlyBaseID: | FBgn0266441 |
Length: | 429 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_024309320.1 |
Gene: | CTPS1 / 1503 |
HGNCID: | 2519 |
Length: | 598 |
Species: | Homo sapiens |
Alignment Length: | 65 |
Identity: | 19/65 - (29%) |
Similarity: | 24/65 - (36%) |
Gaps: | 30/65 - (46%) |
- Green bases have known domain annotations that are detailed below.
Fly 197 EEAHQH----------ALIKAGLL---------RAQLMELEK---------EAEDLSR--KPPPP 231
||.|:| .|.:.||. |.:::|||. ..|.||| ||.||
Human 482 EERHRHRFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPP 546
Fly 232 231
Human 547 546
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG45071 | NP_730024.1 |
MADF |
14..106 |
CDD:214738 |
|
BESS |
384..418 |
CDD:281011 |
|
CTPS1 | XP_024309320.1 |
PLN02327 |
8..563 |
CDD:215186 |
19/65 (29%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S347 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.