DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45071 and LOC100330838

DIOPT Version :9

Sequence 1:NP_730024.1 Gene:CG45071 / 19834908 FlyBaseID:FBgn0266441 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001373242.1 Gene:LOC100330838 / 100330838 -ID:- Length:204 Species:Danio rerio


Alignment Length:157 Identity:38/157 - (24%)
Similarity:62/157 - (39%) Gaps:44/157 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EQFIHDIEERPAIWNR--NFHCNKAFLEQMWDELSGAHKLPKIVLKAKWKGLRDNF----RVEYK 71
            |:.|..:.:.|.::|.  |.:.:.|...:.|..:|...::|:...:.:||.|||.|    |.|.:
Zfish     7 ERLIAAVSDYPELYNSTINSYKDAARKAKAWRAVSLQVEIPEEDCRRRWKSLRDMFIKDKRAEQR 71

  Fly    72 RIPRADNGDFMVDPATFESKWLHYYALLFLTDHMRHRLPKNEQDQSFYFSQQSEDCEKTVVEPDL 136
            |  ||.        .|....|.:.:.:.|||..:        |.:|....:..||.:        
Zfish    72 R--RAS--------GTSHRSWKYSWQMSFLTPFI--------QSRSLAADEPEEDRD-------- 110

  Fly   137 TNGLIRRLQDSDEDYDEEEMEADGEAS 163
                       |||.|||. .|||.::
Zfish   111 -----------DEDKDEER-TADGNSA 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45071NP_730024.1 MADF 14..106 CDD:214738 24/97 (25%)
BESS 384..418 CDD:281011
LOC100330838NP_001373242.1 MADF 8..96 CDD:214738 24/105 (23%)
BESS 167..200 CDD:397204
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.