DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45012 and TMEFF1

DIOPT Version :10

Sequence 1:NP_001285850.1 Gene:CG45012 / 19834795 FlyBaseID:FBgn0266364 Length:65 Species:Drosophila melanogaster
Sequence 2:NP_003683.2 Gene:TMEFF1 / 8577 HGNCID:11866 Length:380 Species:Homo sapiens


Alignment Length:36 Identity:15/36 - (41%)
Similarity:20/36 - (55%) Gaps:4/36 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PVCGSDNITYPHLCFL---ICKAWHENVNFVKKGRC 65
            |||||:..||.:.|||   .||...| :..:.:|.|
Human   109 PVCGSNGDTYQNECFLRRAACKHQKE-ITVIARGPC 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45012NP_001285850.1 KAZAL_FS 26..65 CDD:412159 14/34 (41%)
TMEFF1NP_003683.2 KAZAL 99..143 CDD:197624 14/34 (41%)
KAZAL 189..235 CDD:197624
PHA02887 <275..311 CDD:165214
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 359..380
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.