DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45012 and Spinkl

DIOPT Version :10

Sequence 1:NP_001285850.1 Gene:CG45012 / 19834795 FlyBaseID:FBgn0266364 Length:65 Species:Drosophila melanogaster
Sequence 2:NP_898946.1 Gene:Spinkl / 77424 MGIID:1924674 Length:90 Species:Mus musculus


Alignment Length:45 Identity:15/45 - (33%)
Similarity:22/45 - (48%) Gaps:1/45 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KSRCPCPKISE-PVCGSDNITYPHLCFLICKAWHENVNFVKKGRC 65
            ||:..|..|:| |||..|..||.:.|:...:...|.:.:...|.|
Mouse    43 KSKSECSNIAENPVCADDRNTYYNECYFCIEKVVEKLKYRYHGIC 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45012NP_001285850.1 KAZAL_FS 26..65 CDD:412159 12/39 (31%)
SpinklNP_898946.1 KAZAL_FS 48..>74 CDD:238052 10/25 (40%)

Return to query results.
Submit another query.