DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45012 and LOC4577980

DIOPT Version :10

Sequence 1:NP_001285850.1 Gene:CG45012 / 19834795 FlyBaseID:FBgn0266364 Length:65 Species:Drosophila melanogaster
Sequence 2:XP_001230687.2 Gene:LOC4577980 / 4577980 VectorBaseID:AGAMI1_012281 Length:101 Species:Anopheles gambiae


Alignment Length:42 Identity:13/42 - (30%)
Similarity:22/42 - (52%) Gaps:1/42 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CPCPKISEPVCGSDNITYPHLCFLIC-KAWHENVNFVKKGRC 65
            |.||:..:|:|.|:..||.:.|...| |..:..::...:.||
Mosquito    50 CACPRTYKPLCASNGQTYNNHCAFKCAKQLNATLSVKAQARC 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45012NP_001285850.1 KAZAL_FS 26..65 CDD:412159 10/39 (26%)
LOC4577980XP_001230687.2 None

Return to query results.
Submit another query.