DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45012 and Spink14

DIOPT Version :10

Sequence 1:NP_001285850.1 Gene:CG45012 / 19834795 FlyBaseID:FBgn0266364 Length:65 Species:Drosophila melanogaster
Sequence 2:NP_001034307.2 Gene:Spink14 / 433178 MGIID:3646952 Length:96 Species:Mus musculus


Alignment Length:90 Identity:22/90 - (24%)
Similarity:39/90 - (43%) Gaps:27/90 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CKVVFAVCL-LAVLVLTEAQ---------KSRC---------------PCPKISEPVCGSDNITY 42
            |.|:|::.| |.:|....|:         |.:|               |||.:.:|:||::.:||
Mouse     7 CSVLFSIMLHLVILAAPGARVWWPTHGLIKIKCPYKKVNLSWFNKTVDPCPDLKQPICGTNFVTY 71

  Fly    43 PHLCFLICKAWHE--NVNFVKKGRC 65
            .:.|.|..::...  .:.:...|||
Mouse    72 DNPCILCVESLKSGGRIRYYYNGRC 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45012NP_001285850.1 KAZAL_FS 26..65 CDD:412159 11/40 (28%)
Spink14NP_001034307.2 KAZAL_FS 55..96 CDD:412159 11/40 (28%)

Return to query results.
Submit another query.