DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45012 and Fs

DIOPT Version :10

Sequence 1:NP_001285850.1 Gene:CG45012 / 19834795 FlyBaseID:FBgn0266364 Length:65 Species:Drosophila melanogaster
Sequence 2:XP_061499539.1 Gene:Fs / 1276936 VectorBaseID:AGAMI1_012796 Length:720 Species:Anopheles gambiae


Alignment Length:66 Identity:21/66 - (31%)
Similarity:28/66 - (42%) Gaps:15/66 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 HCKVVFAVCLLAVLVLTEAQKSRCPCPKISEPVCGSDNITYPHLCFLICKAWHEN--VNFVKKGR 64
            ||    ..|.:|     |.:..|.|    ...|||:|.||||.:|.|..:|....  :....:||
Mosquito   568 HC----VSCGVA-----ECRADRSP----KSVVCGTDGITYPSICELKRQACLNGRAIPVAYRGR 619

  Fly    65 C 65
            |
Mosquito   620 C 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45012NP_001285850.1 KAZAL_FS 26..65 CDD:412159 13/40 (33%)
FsXP_061499539.1 None

Return to query results.
Submit another query.