DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45012 and spink2.3

DIOPT Version :10

Sequence 1:NP_001285850.1 Gene:CG45012 / 19834795 FlyBaseID:FBgn0266364 Length:65 Species:Drosophila melanogaster
Sequence 2:XP_005157264.1 Gene:spink2.3 / 101882741 ZFINID:ZDB-GENE-141216-190 Length:76 Species:Danio rerio


Alignment Length:72 Identity:22/72 - (30%)
Similarity:30/72 - (41%) Gaps:16/72 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VCLLAVLVLTEAQKSRCP------------CPKISEPVCGSDNITYPHLCFLICKAWHENVNFV- 60
            |.||::..:..|... ||            |.....||||:|..||.:.|.|....:.|.:|.: 
Zfish     6 VLLLSLAAMATAADD-CPSVPNCGKYHLPACTMDYRPVCGTDGNTYGNECVLCGNIFKEKLNIIL 69

  Fly    61 --KKGRC 65
              |||.|
Zfish    70 ISKKGEC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45012NP_001285850.1 KAZAL_FS 26..65 CDD:412159 16/53 (30%)
spink2.3XP_005157264.1 KAZAL_FS 31..76 CDD:412159 15/44 (34%)

Return to query results.
Submit another query.