DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45012 and spink2.8

DIOPT Version :10

Sequence 1:NP_001285850.1 Gene:CG45012 / 19834795 FlyBaseID:FBgn0266364 Length:65 Species:Drosophila melanogaster
Sequence 2:NP_001373478.1 Gene:spink2.8 / 100537943 ZFINID:ZDB-GENE-141216-151 Length:78 Species:Danio rerio


Alignment Length:74 Identity:23/74 - (31%)
Similarity:29/74 - (39%) Gaps:17/74 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VCLLAVLVLTEAQKSRCP--------------CPKISEPVCGSDNITYPHLCFLICKAWHENVNF 59
            :.||..|.........||              |.....||||:|.||||:.|.|....:.|.:|.
Zfish     5 IFLLLSLAAMATAADDCPLVPNCGKYHLLLPACTDDYTPVCGTDGITYPNECNLCATIFKEMLNI 69

  Fly    60 V---KKGRC 65
            :   |||.|
Zfish    70 ILISKKGEC 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45012NP_001285850.1 KAZAL_FS 26..65 CDD:412159 18/55 (33%)
spink2.8NP_001373478.1 KAZAL_FS 34..78 CDD:412159 17/43 (40%)

Return to query results.
Submit another query.