DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45012 and Spink10

DIOPT Version :10

Sequence 1:NP_001285850.1 Gene:CG45012 / 19834795 FlyBaseID:FBgn0266364 Length:65 Species:Drosophila melanogaster
Sequence 2:XP_002728606.3 Gene:Spink10 / 100361300 RGDID:2320365 Length:160 Species:Rattus norvegicus


Alignment Length:77 Identity:17/77 - (22%)
Similarity:30/77 - (38%) Gaps:27/77 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KVVFAVCLLAV------LVLTEAQKSRCPCPKISE----------PVCGSDNITYPHLCFLICKA 52
            |::|.:.|:.:      ...::..:.:..|.|..|          ||||::..||.:.| :.|.|
  Rat    85 KIIFILALVGLFYYETTFTFSKQVRHKPDCDKYKEFPNRCTREINPVCGTNGHTYDNEC-IFCNA 148

  Fly    53 ----------WH 54
                      ||
  Rat   149 MITSKGKIDYWH 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45012NP_001285850.1 KAZAL_FS 26..65 CDD:412159 14/49 (29%)
Spink10XP_002728606.3 KAZAL_FS 37..>71 CDD:412159
Kazal_1 114..157 CDD:395004 12/43 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.