DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45012 and Gm10267

DIOPT Version :10

Sequence 1:NP_001285850.1 Gene:CG45012 / 19834795 FlyBaseID:FBgn0266364 Length:65 Species:Drosophila melanogaster
Sequence 2:NP_001268399.1 Gene:Gm10267 / 100042855 MGIID:3642556 Length:85 Species:Mus musculus


Alignment Length:54 Identity:16/54 - (29%)
Similarity:28/54 - (51%) Gaps:4/54 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVLTEAQKSRCPCPKISEPVCGSDNITYPHLCFLICKAWHEN-VNFVKK--GRC 65
            :|:.....|:..|.:...|||.::..||.:.| :.|.|:.|| .:|:..  |:|
Mouse    33 IVMCRGFSSKRICTREYFPVCATNGRTYFNKC-IFCLAYRENDGSFIMSHLGKC 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45012NP_001285850.1 KAZAL_FS 26..65 CDD:412159 13/41 (32%)
Gm10267NP_001268399.1 Kazal_1 41..85 CDD:395004 14/44 (32%)

Return to query results.
Submit another query.