DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45012 and tmeff2a

DIOPT Version :10

Sequence 1:NP_001285850.1 Gene:CG45012 / 19834795 FlyBaseID:FBgn0266364 Length:65 Species:Drosophila melanogaster
Sequence 2:NP_001121837.1 Gene:tmeff2a / 100004613 ZFINID:ZDB-GENE-070912-622 Length:379 Species:Danio rerio


Alignment Length:36 Identity:16/36 - (44%)
Similarity:20/36 - (55%) Gaps:4/36 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PVCGSDNITYPHLCFL---ICKAWHENVNFVKKGRC 65
            |||||:|..|.:.|||   .||...| :..|.:|.|
Zfish   105 PVCGSNNENYENECFLRRDACKQQTE-ILVVSEGSC 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45012NP_001285850.1 KAZAL_FS 26..65 CDD:412159 15/34 (44%)
tmeff2aNP_001121837.1 KAZAL_FS 99..139 CDD:238052 15/34 (44%)
KAZAL 186..232 CDD:197624
PHA02887 <266..306 CDD:165214
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.