DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf4 and CG32847

DIOPT Version :9

Sequence 1:NP_001291198.1 Gene:Rnf4 / 19822 MGIID:1201691 Length:194 Species:Mus musculus
Sequence 2:NP_730026.1 Gene:CG32847 / 318245 FlyBaseID:FBgn0052847 Length:164 Species:Drosophila melanogaster


Alignment Length:77 Identity:22/77 - (28%)
Similarity:33/77 - (42%) Gaps:18/77 - (23%)


- Green bases have known domain annotations that are detailed below.


Mouse   120 TKDDGATGPRPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRD---SLKNANTCPTCR 181
            |||:        ....|.||:|    ..||.   |.:.|||:||..||..   :..:...||.|:
  Fly    10 TKDE--------SFYECNICLD----TAQNA---VVSMCGHLFCWPCLYQWILTKPDHTVCPVCK 59

Mouse   182 KKINHKRYHPIY 193
            ..::..:..|:|
  Fly    60 SGVDRSKVIPVY 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf4NP_001291198.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39
Required for ubiquitination activity 1..20
Mediates interaction with TRPS1. /evidence=ECO:0000269|PubMed:12885770 6..65
SUMO interaction motif 1, mediates the binding to polysumoylated substrates. /evidence=ECO:0000250|UniProtKB:P78317 40..43
SUMO interaction motif 2, mediates the binding to polysumoylated substrates. /evidence=ECO:0000250|UniProtKB:P78317 50..53
SUMO interaction motif 3, mediates the binding to polysumoylated substrates. /evidence=ECO:0000250|UniProtKB:P78317 61..63
SUMO interaction motif 4, mediates the binding to polysumoylated substrates. /evidence=ECO:0000250|UniProtKB:P78317 71..74
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..130 3/9 (33%)
zf-RING_2 135..181 CDD:290367 16/48 (33%)
CG32847NP_730026.1 PLN03208 4..>91 CDD:178747 22/77 (29%)
RING 17..60 CDD:238093 17/49 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.