DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rit2 and Rala

DIOPT Version :9

Sequence 1:NP_033091.1 Gene:Rit2 / 19762 MGIID:108054 Length:217 Species:Mus musculus
Sequence 2:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster


Alignment Length:199 Identity:80/199 - (40%)
Similarity:121/199 - (60%) Gaps:9/199 - (4%)


- Green bases have known domain annotations that are detailed below.


Mouse    15 SGGSREYKVVMLGAGGVGKSAVTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQA 79
            :.|...:||:|:|:|||||||:|:||:..:|.:.::||..|:|:.:|.:|.|...:||||||||.
  Fly     6 TAGPALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQE 70

Mouse    80 EFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQFRQVS 144
            ::.|:|:.|.|.||||:..:|:||.:|||...:|:|.|.:|::...||.:|||||.||...|:|.
  Fly    71 DYAAIRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDKRKVP 135

Mouse   145 TEEGMNLARDYNCAFFETSAALRFGIDDAFQGLVREIRRKESMLSLVERKLKRKDSLWKKIKASL 209
            ..|....|:.:...:.||||..|..:|..|..|:||||         .||.:...:...:.|...
  Fly   136 LSECQLRAQQWAVPYVETSAKTRENVDKVFFDLMREIR---------SRKTEDSKATSGRAKDRC 191

Mouse   210 KKKR 213
            ||:|
  Fly   192 KKRR 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rit2NP_033091.1 Rit_Rin_Ric 19..190 CDD:206712 73/170 (43%)
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 73/170 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.