DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rheb and Rheb

DIOPT Version :9

Sequence 1:NP_444305.2 Gene:Rheb / 19744 MGIID:97912 Length:184 Species:Mus musculus
Sequence 2:NP_730950.2 Gene:Rheb / 117332 FlyBaseID:FBgn0041191 Length:182 Species:Drosophila melanogaster


Alignment Length:183 Identity:117/183 - (63%)
Similarity:148/183 - (80%) Gaps:2/183 - (1%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQD 65
            || :|.|.||::||||||||||.||||||||||||||||||||||:..|..|:|.::|:||||||
  Fly     1 MP-TKERHIAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTAGQD 64

Mouse    66 EYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVIS 130
            ||||||..||:|.:||:||||:||.|||||:|:|:.||||::||..:|::|||||.|||.||.:|
  Fly    65 EYSIFPVQYSMDYHGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQERTVS 129

Mouse   131 YEEGKALAESWNAAFLESSAKENQTAVDVFKRIILEAEKIDGAASQGKSSCSV 183
            .||||.|||||.|||||:|||:|::..|:|.::::..|..:| ..|.||.|.|
  Fly   130 TEEGKKLAESWRAAFLETSAKQNESVGDIFHQLLILIENENG-NPQEKSGCLV 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhebNP_444305.2 RheB 6..184 CDD:206709 114/178 (64%)
Effector region 35..43 7/7 (100%)
RhebNP_730950.2 RheB 5..182 CDD:206709 113/176 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 225 1.000 Domainoid score I2535
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 233 1.000 Inparanoid score I3405
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002658
OrthoInspector 1 1.000 - - oto93849
orthoMCL 1 0.900 - - OOG6_104157
Panther 1 1.100 - - LDO PTHR24070
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1095
SonicParanoid 1 1.000 - - X2033
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.850

Return to query results.
Submit another query.