Sequence 1: | NP_033088.2 | Gene: | Rgs4 / 19736 | MGIID: | 108409 | Length: | 205 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_733336.1 | Gene: | Axn / 43565 | FlyBaseID: | FBgn0026597 | Length: | 745 | Species: | Drosophila melanogaster |
Alignment Length: | 210 | Identity: | 44/210 - (20%) |
---|---|---|---|
Similarity: | 76/210 - (36%) | Gaps: | 30/210 - (14%) |
- Green bases have known domain annotations that are detailed below.
Mouse 21 HRLGFLLQKSDSC---------EHSSSHSKKDKVVTCQRVSQEEVKKWAESLENLIHHECGLAAF 76
Mouse 77 KAFLKSE---YSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETS 138
Mouse 139 RNMLQPTIT----CFDEAQKKIFNLMEKDSYRRFLKSRFYLDLTNPSSCGAEK--QKGAKSSADC 197
Mouse 198 -------TSLVSQCA 205 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rgs4 | NP_033088.2 | RGS_RGS4 | 63..176 | CDD:188669 | 26/119 (22%) |
Axn | NP_733336.1 | RGS | 55..170 | CDD:295367 | 26/119 (22%) |
Axin_b-cat_bind | 494..543 | CDD:285982 | |||
DIX | 665..739 | CDD:279160 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3589 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |