DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgs16 and Axn

DIOPT Version :9

Sequence 1:NP_035397.2 Gene:Rgs16 / 19734 MGIID:108407 Length:201 Species:Mus musculus
Sequence 2:NP_733336.1 Gene:Axn / 43565 FlyBaseID:FBgn0026597 Length:745 Species:Drosophila melanogaster


Alignment Length:176 Identity:40/176 - (22%)
Similarity:77/176 - (43%) Gaps:22/176 - (12%)


- Green bases have known domain annotations that are detailed below.


Mouse    29 KSELSSDTGGISKFEWASKHNKERSFSEDVLGWRESFDLLLNSKNGVAAFHAFLKTEFS--EENL 91
            :|.:...|.|::        :..::.|...|.|..:.:.||..::||..|..:::.|..  .::|
  Fly    27 ESRVKKMTEGVA--------DTSKNSSPSYLNWARTLNHLLEDRDGVELFKKYVEEEAPAYNDHL 83

Mouse    92 EFWLACEEFKKIRSATKLASRAHHIFDEYIRSEAPKEVNIDHETR---ELTKTNLQ-AATTSCFD 152
            .|:.|||..|:.....|:......|: .::|.   .:::|..:.|   :..|||.: ..:...||
  Fly    84 NFYFACEGLKQQTDPEKIKQIIGAIY-RFLRK---SQLSISDDLRAQIKAIKTNPEIPLSPHIFD 144

Mouse   153 VAQGKTRTLMEKDSYPRFLKSPAY----RDLAAQASATSTSAPSGS 194
            ..|......:..:.||.||.|..|    :.::||....::|..:||
  Fly   145 PMQRHVEVTIRDNIYPTFLCSEMYILYIQQMSAQQERCTSSGATGS 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rgs16NP_035397.2 RGS_RGS16 65..178 CDD:188665 29/122 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 181..201 5/14 (36%)
AxnNP_733336.1 RGS 55..170 CDD:295367 29/118 (25%)
Axin_b-cat_bind 494..543 CDD:285982
DIX 665..739 CDD:279160
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.