DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Relb and Dif

DIOPT Version :9

Sequence 1:NP_033072.2 Gene:Relb / 19698 MGIID:103289 Length:558 Species:Mus musculus
Sequence 2:NP_001162998.1 Gene:Dif / 35045 FlyBaseID:FBgn0011274 Length:987 Species:Drosophila melanogaster


Alignment Length:417 Identity:132/417 - (31%)
Similarity:197/417 - (47%) Gaps:69/417 - (16%)


- Green bases have known domain annotations that are detailed below.


Mouse    34 DELEIIDEYIKENGFGLDG-----------------TQLSEMPRLVPRGPASLSSVTLGPAAPPP 81
            |..|||:..::.||....|                 :|.:.:|.:....|..|.:..:....|.|
  Fly     8 DIQEIINASMELNGGATGGGSVAGAVGGGGAAHHILSQSTSLPVMPSHIPLHLQNQNMNQNLPEP 72

Mouse    82 PATPSWSCTLGRLVSPGPCPRPYLVITEQPKQRGMRFRYECEGRSAGSILG-ESSTEASKTLPAI 145
            .|...                |:|.|.|:|....:||||:||||:||||.| .||:|..||.|.|
  Fly    73 SARSG----------------PHLRIVEEPTSNIIRFRYKCEGRTAGSIPGMNSSSETGKTFPTI 121

Mouse   146 ELRDCGGLREVEVTACLVWKDWPHRVHPHSLVGKD----CTDGVCRVRLRPHVSPRHSFNNLGIQ 206
            |:.:..|  .|.:....|..|.|.|.|||.||.|:    |..|:.:.:|.|. ..|.....:|||
  Fly   122 EVCNYDG--PVIIVVSCVTSDEPFRQHPHWLVSKEEADACKSGIYQKKLPPE-ERRLVLQKVGIQ 183

Mouse   207 CVRKKEIEAAIERKIQLGIDPYNAGSLKNHQE----VDMNVVRICFQASYRDQQGHLHRMDPILS 267
            |.:|.|:..::..:.:..|||:||..  :|::    ::...:|:|:||........: .:|||:|
  Fly   184 CAKKLEMRDSLVERERRNIDPFNAKF--DHKDQIDKINRYELRLCYQAFITVGNSKV-PLDPIVS 245

Mouse   268 EPVYDKKSTNTSELRICRINKESGPCTGGEELYLLCDKVQKEDISVVF------STASWEGRADF 326
            .|:|.|    :|||.|.|:...:....||:|:.:||:|:.|:||.|.|      ...:|...|:|
  Fly   246 SPIYGK----SSELTITRLCSCAATANGGDEIIMLCEKIAKDDIEVRFYETDKDGRETWFANAEF 306

Mouse   327 SQADVHRQIAIVFKTPPYEDLEISEPVTVNVFLQRLTDGVCSEPLPFTYLPRDHDSYGV------ 385
            ...||.:|:||.||||.|.:.||::.|.|.:.|.|.:||..|.||||.|.|..    |.      
  Fly   307 QPTDVFKQMAIAFKTPRYRNTEITQSVNVELKLVRPSDGATSAPLPFEYYPNP----GTVTFARL 367

Mouse   386 -DKKRKRGLPDVLGELSSSDPHGIESK 411
             .|.::|...||..::.|.|.....:|
  Fly   368 QRKLKRRQELDVFQQILSLDSETTATK 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RelbNP_033072.2 RelB_leu_zip 1..75 CDD:292798 11/57 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Leucine-zipper 22..50 6/15 (40%)
RHD-n_RelB 103..274 CDD:143646 65/179 (36%)
RHD_dimer 282..378 CDD:292797 40/101 (40%)
RelB_transactiv 381..558 CDD:292799 8/38 (21%)
Nuclear localization signal. /evidence=ECO:0000255 387..391 1/3 (33%)
Nuclear localization signal. /evidence=ECO:0000255 411..416 1/1 (100%)
DifNP_001162998.1 RHD-n_Dorsal_Dif 78..252 CDD:143647 66/183 (36%)
RHD_dimer 256..358 CDD:292797 40/101 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847949
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 205 1.000 Inparanoid score I3721
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D391433at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8810
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24169
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4542
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.990

Return to query results.
Submit another query.