DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Reg1 and CG7763

DIOPT Version :9

Sequence 1:NP_033068.1 Gene:Reg1 / 19692 MGIID:97895 Length:165 Species:Mus musculus
Sequence 2:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster


Alignment Length:164 Identity:43/164 - (26%)
Similarity:62/164 - (37%) Gaps:42/164 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse    13 LIVLSPSQGQEAEEDLPSARISCPEGSNAYSSYCYYFTEDRLTWADADLFCQNMNSGYLVSVLSQ 77
            |:....:.|::.||:....::.        |.|.|...|::|.|.||...|..| .|:|.|:.||
  Fly    92 LLTHGTAMGRKLEENEIFQQLG--------SKYYYIEKEEKLNWHDALDKCHKM-GGHLASLQSQ 147

Mouse    78 AE-GNFVASLIKESGTTDANVWTGLHDPKRNRRW-------------HWSSGSLFLYKSWATGSP 128
            .| ..|            .|...||     ||.|             ..:.||...:.|||.|.|
  Fly   148 EELDRF------------NNQLNGL-----NRYWIDVTNQFNESEFVSVTKGSKANFLSWADGEP 195

Mouse   129 NSSNRGYCVSLTSNTGYKKWKDDNCDAQYSFVCK 162
            ...  |.||.:.:..|.....|::|.|...|:|:
  Fly   196 TKD--GECVDIRTFNGKTTMNDNSCFANLYFICE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Reg1NP_033068.1 CLECT 35..163 CDD:295302 39/142 (27%)
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 38/132 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.