Sequence 1: | NP_001273174.1 | Gene: | DTX3 / 196403 | HGNCID: | 24457 | Length: | 350 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_508904.2 | Gene: | C26B9.6 / 182932 | WormBaseID: | WBGene00016135 | Length: | 306 | Species: | Caenorhabditis elegans |
Alignment Length: | 197 | Identity: | 36/197 - (18%) |
---|---|---|---|
Similarity: | 60/197 - (30%) | Gaps: | 75/197 - (38%) |
- Green bases have known domain annotations that are detailed below.
Human 16 GTCKNKVTVSKPVWDF---LSKETPARLARLREEHRVSILIDGETSDIYVLQLSPQGPPPAPPNG 77
Human 78 LYLARKALKGLLKEAEKELKKAQR----QGELMGCLALGGGGEHPEMHRAGPPPLRAAPLLPPGA 138
Human 139 RGLPPPPPPLPPPLPPRLREEAEEQESTCPICLGEIQNAKTLEKCRHSFCEGCITRALQVKKACP 203
Human 204 MC 205 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DTX3 | NP_001273174.1 | RING-HC_DTX3 | 166..206 | CDD:319625 | 12/40 (30%) |
DTC | 213..347 | CDD:407937 | |||
C26B9.6 | NP_508904.2 | WWE | 10..83 | CDD:128922 | 17/92 (18%) |
RING | 107..149 | CDD:238093 | 12/39 (31%) | ||
WWE | 213..288 | CDD:128922 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R10345 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |