DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DTX3 and C26B9.6

DIOPT Version :9

Sequence 1:NP_001273174.1 Gene:DTX3 / 196403 HGNCID:24457 Length:350 Species:Homo sapiens
Sequence 2:NP_508904.2 Gene:C26B9.6 / 182932 WormBaseID:WBGene00016135 Length:306 Species:Caenorhabditis elegans


Alignment Length:197 Identity:36/197 - (18%)
Similarity:60/197 - (30%) Gaps:75/197 - (38%)


- Green bases have known domain annotations that are detailed below.


Human    16 GTCKNKVTVSKPVWDF---LSKETPARLARLREEHRVSILIDGETSDIYVLQLSPQGPPPAPPNG 77
            |.||:.      :::|   |.:.......|.::..:|||.....|.|.                 
 Worm    17 GNCKSN------MYEFHKDLQEHIENSYKRKKKTCKVSIFGVTHTIDF----------------- 58

Human    78 LYLARKALKGLLKEAEKELKKAQR----QGELMGCLALGGGGEHPEMHRAGPPPLRAAPLLPPGA 138
                .|.||...:....|:|:..|    |..::||              ||.|.::         
 Worm    59 ----EKMLKYRNRPNTSEVKRITRSQAKQYGVLGC--------------AGVPYMK--------- 96

Human   139 RGLPPPPPPLPPPLPPRLREEAEEQESTCPICLGEIQNAKTLEKCRHSFCEGCITRALQVKKACP 203
                              :|..::....|.||..::.....:|.|.|.||..|:.....:...||
 Worm    97 ------------------KEGFQQDHDICYICYYKLTIPTRIENCGHEFCYVCLKSNFAMGNDCP 143

Human   204 MC 205
            :|
 Worm   144 VC 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DTX3NP_001273174.1 RING-HC_DTX3 166..206 CDD:319625 12/40 (30%)
DTC 213..347 CDD:407937
C26B9.6NP_508904.2 WWE 10..83 CDD:128922 17/92 (18%)
RING 107..149 CDD:238093 12/39 (31%)
WWE 213..288 CDD:128922
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10345
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.