DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EGR3 and btd

DIOPT Version :9

Sequence 1:XP_005273482.1 Gene:EGR3 / 1960 HGNCID:3240 Length:442 Species:Homo sapiens
Sequence 2:NP_511100.1 Gene:btd / 31912 FlyBaseID:FBgn0000233 Length:644 Species:Drosophila melanogaster


Alignment Length:469 Identity:114/469 - (24%)
Similarity:164/469 - (34%) Gaps:135/469 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    22 LRSEDKASERSGSATREQRAWGASPGRERRGVLERTGPREEAELCAVESESPARSGSETTCSCSY 86
            |..:.:..::.....::|:.....|.:::...|         ...|:.|..|:.|||.:..|...
  Fly    61 LTQQQQQQQQQQQQQQQQQQQQQQPQQQQHDFL---------SAAALLSAPPSLSGSSSGSSSGS 116

Human    87 LP---APPREEQQCFSRARACVCENVMDIGLTNEKPNPELSYSG------SFQPAPGNKTVTYLG 142
            .|   .||                      :..|.|.|:.|.:|      |.|.||.:.:|:   
  Fly   117 SPLYGKPP----------------------MKLELPYPQASSTGTASPNSSIQSAPSSASVS--- 156

Human   143 KFAFDSPSNWCQDNIISLMSAGILGVPP---ASGALSTQTSTASMVQPPQGDVEAMYPALPPYSN 204
            ...|.||:........|..:......||   |:|||:...:::|   |......|...|....:.
  Fly   157 PSIFPSPAQSFASISASPSTPTTTLAPPTTAAAGALAGSPTSSS---PSSSAASAAAAAAAAAAA 218

Human   205 CGDLYSEPVSFHDPQGNPGLAYS-PQDYQSAKPALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQ 268
            ..||.:..|:        ..||. ...|....||  .:.|| ...|...::.|.:|.......|.
  Fly   219 AADLGAAAVA--------SAAYGWNTAYSGLGPA--RSQFP-YAQYASDYYGNAVGMSSSAAWFS 272

Human   269 GMDPIRVNPPPITPLETIKAFKDKQIHPGFG-----------------SLPQ--------PPLTL 308
            ..:  |:..|           ...|.:|||.                 :.|.        ||:..
  Fly   273 HQE--RLYQP-----------WSSQSYPGFNFDDIAFQTQLQRRSVRCTCPNCTNEMSGLPPIVG 324

Human   309 KPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSD 373
            ...|.||             .|.|...||:|.:.::..|..|||.|||.:||.|..|.:.|||||
  Fly   325 PDERGRK-------------QHICHIPGCERLYGKASHLKTHLRWHTGERPFLCLTCGKRFSRSD 376

Human   374 HLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQK--------------------EKKA 418
            .|..|.||||..:|:||..|.:||:|||...:|.|.|.|.|                    |||.
  Fly   377 ELQRHGRTHTNYRPYACPICSKKFSRSDHLSKHKKTHFKDKKSKKVLAAEAKEQAAAAIKLEKKE 441

Human   419 EKGGAPSASSAPPV 432
            :|.|.|   ..|||
  Fly   442 KKSGKP---LTPPV 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EGR3XP_005273482.1 DUF3446 142..202 CDD:288757 14/62 (23%)
COG5048 324..>388 CDD:227381 27/63 (43%)
zf-C2H2 330..354 CDD:278523 9/23 (39%)
C2H2 Zn finger 332..354 CDD:275368 8/21 (38%)
zf-H2C2_2 346..371 CDD:290200 12/24 (50%)
COG5048 358..>431 CDD:227381 35/92 (38%)
C2H2 Zn finger 362..382 CDD:275368 10/19 (53%)
zf-H2C2_2 374..399 CDD:290200 12/24 (50%)
C2H2 Zn finger 390..410 CDD:275368 9/19 (47%)
btdNP_511100.1 C2H2 Zn finger 338..357 CDD:275368 7/18 (39%)
zf-H2C2_2 349..374 CDD:290200 12/24 (50%)
C2H2 Zn finger 365..385 CDD:275368 10/19 (53%)
zf-H2C2_2 377..402 CDD:290200 12/24 (50%)
zf-C2H2 391..413 CDD:278523 10/21 (48%)
C2H2 Zn finger 393..413 CDD:275368 9/19 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I4604
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.