DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EGR2 and cbt

DIOPT Version :9

Sequence 1:XP_011537729.1 Gene:EGR2 / 1959 HGNCID:3239 Length:489 Species:Homo sapiens
Sequence 2:NP_722636.1 Gene:cbt / 33224 FlyBaseID:FBgn0043364 Length:428 Species:Drosophila melanogaster


Alignment Length:494 Identity:119/494 - (24%)
Similarity:179/494 - (36%) Gaps:143/494 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    19 PRDPPERRRSGLAHVLSDNIYPVEDLAATSVTIFPNAELGGPFDQMNGVAGDGMI---------- 73
            |..|| .|.:.|..|..|.....|:|....:      :|.....|.||    |:|          
  Fly    11 PATPP-LRENKLEIVAKDEQQVNENLLKAKL------KLVAQKSQKNG----GIITPNPSDTEDE 64

Human    74 --NIDMTGEKRSLDLPYPSSFAPVSAPRNQTFTYMGKFSIDPQYPGASCYPEGIINIVSAGILQG 136
              .|.:..:|..|:.|..|    ::.|.:|      |...|.:....|.    |:.:.|:|.:..
  Fly    65 APEIAVPNKKPRLEQPAMS----MTPPPDQ------KLDDDQKAERVSV----IMRVNSSGAVSS 115

Human   137 VTSPASTTASSSVTSASPNPLATGPLGVCTMSQTQPDLDHLYSPPPPPPPYSGCAGDLYQDPSAF 201
            .:...::::|:|..|:|.|          |.:.|.       |.||       ...|.|.:.:.:
  Fly   116 SSQDENSSSSTSCCSSSSN----------TNTSTS-------SVPP-------TVEDDYPEANVW 156

Human   202 LS---AATTSTSSSLAYPP--PPSYPSPKPATDPGLFPMIPDYPGFFPSQCQRDLHGTAGPDRKP 261
            .:   ......::.:|.||  .|..|..|..|.|.            |::|.::           
  Fly   157 RNLKFKMNRKRAAEVALPPVQTPETPVAKLVTPPA------------PAECIKE----------- 198

Human   262 FPCPLDTLRVPPPLTPLSTIRNFTLGGPSAGVTGPGASGGSEGPRLPGSSSAAAAAAAAAAYNPH 326
                   ..:.|.|||:              ...|.||..|:         ....:..||..:|.
  Fly   199 -------EEIKPILTPI--------------YVSPVASSASQ---------LILLSTVAAQQSPT 233

Human   327 HLPLRPILRPRKYPNR---PSKTPVHERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCR-- 386
            .:|..|.:...|...|   ........|.|.|....|.:.:.:|..|..|.|:|||.:||.|:  
  Fly   234 PVPKTPTMSEEKLTTRITAAQAAATRSRIYECSFPDCGKNYFKSSHLKAHQRVHTGERPFICKWE 298

Human   387 ICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQKER--------KSSA 443
            .|.:.|||||.|:.|.|||||||.|.|..|.:||.|||...:|.|.|.:.|..        .::.
  Fly   299 NCDKRFSRSDELSRHKRTHTGEKKFQCSVCQKKFMRSDHLSKHVKRHNKDKANGVNRHVSLANNN 363

Human   444 PSASVPAPSTASCSG-----GVQPGGTLCSS---NSSSL 474
            .||||.|   :.|..     .:.|.|:..||   :|:||
  Fly   364 TSASVAA---SLCDASLHLRAIAPAGSSASSSPISSASL 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EGR2XP_011537729.1 DUF3446 107..179 CDD:403215 13/71 (18%)
zf-C2H2 353..377 CDD:395048 7/23 (30%)
C2H2 Zn finger 355..377 CDD:275368 6/21 (29%)
COG5048 381..>449 CDD:227381 33/77 (43%)
C2H2 Zn finger 385..405 CDD:275368 10/21 (48%)
C2H2 Zn finger 413..433 CDD:275368 9/19 (47%)
cbtNP_722636.1 zf-C2H2 263..287 CDD:278523 7/23 (30%)
C2H2 Zn finger 265..287 CDD:275368 6/21 (29%)
COG5048 <270..362 CDD:227381 38/91 (42%)
zf-H2C2_2 279..306 CDD:290200 11/26 (42%)
C2H2 Zn finger 295..317 CDD:275368 10/21 (48%)
zf-H2C2_2 309..332 CDD:290200 12/22 (55%)
zf-C2H2 323..345 CDD:278523 10/21 (48%)
C2H2 Zn finger 325..345 CDD:275368 9/19 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.