DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eef1g and AIMP3

DIOPT Version :9

Sequence 1:NP_775370.1 Gene:eef1g / 195822 ZFINID:ZDB-GENE-020423-3 Length:442 Species:Danio rerio
Sequence 2:NP_660194.1 Gene:AIMP3 / 246507 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster


Alignment Length:102 Identity:29/102 - (28%)
Similarity:49/102 - (48%) Gaps:20/102 - (19%)


- Green bases have known domain annotations that are detailed below.


Zfish    90 QASAQVLQWVSFADSEVIPPASAWVFPTLGIMQFNKQATEQAKEEVKRVLAVLNQHLNTRTFLVG 154
            :..|||.||:.|:...|.|.:                   :.|...|::||..|:...::::|||
  Fly    66 EVEAQVYQWIEFSVLYVAPGS-------------------KDKYVSKQLLADFNKLFASKSYLVG 111

Zfish   155 ERISLADITVVCSLLWLYKQVLELAFRQPYPNVTRWF 191
            ..|:|||:.|..::..|.|. |....::.|.|::|||
  Fly   112 HFITLADLAVYYAIYDLVKS-LSPVDKEVYLNLSRWF 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eef1gNP_775370.1 GST_N_EF1Bgamma 4..82 CDD:239342
maiA 5..201 CDD:273527 29/102 (28%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 29/101 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..273
EF1G 280..386 CDD:279041
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 29/102 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.