DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MEGF9 and NetA

DIOPT Version :9

Sequence 1:NP_001073966.2 Gene:MEGF9 / 1955 HGNCID:3234 Length:602 Species:Homo sapiens
Sequence 2:NP_001285243.1 Gene:NetA / 32398 FlyBaseID:FBgn0015773 Length:726 Species:Drosophila melanogaster


Alignment Length:375 Identity:88/375 - (23%)
Similarity:114/375 - (30%) Gaps:144/375 - (38%)


- Green bases have known domain annotations that are detailed below.


Human    87 VHRPLAATSPAQSPETTPL------------WATAGPSSTTFQAPLGPSPTTPPAAERTSTTSQA 139
            |.|||.:.....:.|..|.            |.||......|.....|.|             ||
  Fly   204 VTRPLVSRIAFSTLEGRPSSRDLDSSPVLQDWVTATDIRVVFHRLQRPDP-------------QA 255

Human   140 PTRPAPTTLSTTTGPAPTTPVATTVPAPTTPRTPTPDLPSSSNSSVLPTPPATE----------A 194
                   .||...|.|                   .||.|...|..|...||..          |
  Fly   256 -------LLSLEAGGA-------------------TDLASGKYSVPLANGPAGNNIEANLGGDVA 294

Human   195 PSSPPPEYVCNCSVVGSLNVNRCNQTTGQCECRPGYQGLHCETCKEGFYLNYTSGLCQPCDCSPH 259
            .|.....|..:...||           |:|:|                     :|....|.....
  Fly   295 TSGSGLHYAISDFSVG-----------GRCKC---------------------NGHASKCSTDAS 327

Human   260 GALSIPCNSSGKCQCKVGVIGSICDRCQDGYY--------GFSKNGCLPCQCNNRSASC------ 310
            |.|:        |:|.....|..|:||:..::        ....|.|..|.||..:..|      
  Fly   328 GQLN--------CECSHNTAGRDCERCKPFHFDRPWARATAKEANECKECNCNKHARQCRFNMEI 384

Human   311 -----DALTGACLNCQENSKGNHCEECKEGFYQSPDATKE------CLRCPCSAVTSTGS-CSIK 363
                 ....|.|.||:.::.|.:|.:||||||:  ||||.      |..|.|..:.|:|. |:..
  Fly   385 FRLSQGVSGGVCQNCRHSTTGRNCHQCKEGFYR--DATKPLTHRKVCKACDCHPIGSSGKICNST 447

Human   364 SSELEPECDQCKDGYIGPNCNKCENGYYNFDSICRKCQCHGHVDP-VKTP 412
            |.    :| .||||..|..||:|..||.         |...|:.| :|.|
  Fly   448 SG----QC-PCKDGVTGLTCNRCARGYQ---------QSRSHIAPCIKQP 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MEGF9NP_001073966.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..199 27/133 (20%)
EGF_Lam 204..252 CDD:238012 6/47 (13%)
Laminin_EGF 254..301 CDD:278482 11/54 (20%)
EGF_Lam 300..346 CDD:238012 20/62 (32%)
EGF_Lam <373..401 CDD:238012 10/27 (37%)
Laminin_EGF 400..>441 CDD:278482 5/14 (36%)
NetANP_001285243.1 LamNT 44..280 CDD:214532 23/114 (20%)
EGF_Lam 312..357 CDD:238012 12/73 (16%)
EGF_Lam 369..426 CDD:238012 20/58 (34%)
EGF_Lam 431..479 CDD:238012 19/61 (31%)
NTR_netrin-1_like 545..723 CDD:239634
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.