DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MEGF6 and NimA

DIOPT Version :9

Sequence 1:XP_011539187.1 Gene:MEGF6 / 1953 HGNCID:3232 Length:1603 Species:Homo sapiens
Sequence 2:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster


Alignment Length:125 Identity:53/125 - (42%)
Similarity:68/125 - (54%) Gaps:8/125 - (6%)


- Green bases have known domain annotations that are detailed below.


Human   920 RACDTGHWG------PDCSHPCNCSAGHGSCDAISGLCLCEAGYVGPRCEQQCPQGHFGPGCEQR 978
            |.|..|:.|      ..|...|....|.||| .:..:|.||.||:|..|.|:|....:|..|:..
  Fly   110 RFCCQGYEGNLSDSQATCKPICRGGCGRGSC-VMPDICSCEEGYIGKHCTQRCDHDRWGLDCKNL 173

Human   979 CQCQHGAACDHVSGACTCPAGWRGTFCEHACPAGFFGLDCRSACNCTAGAACDAVNGSCL 1038
            ||||:|||||:.||.|.|.|||.|.|||..||.|.:|:.||.||:|.. ..|:...|:|:
  Fly   174 CQCQNGAACDNKSGLCHCIAGWTGQFCELPCPQGTYGIMCRKACDCDE-KPCNPQTGACI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MEGF6XP_011539187.1 EMI 108..176 CDD:284877
vWFA <215..261 CDD:294047
FXa_inhibition 268..304 CDD:291342
vWFA <342..384 CDD:294047
FXa_inhibition 397..432 CDD:291342
vWFA <432..469 CDD:294047
vWFA <472..511 CDD:294047
NimANP_001285918.1 EMI 52..116 CDD:284877 2/5 (40%)
EGF_2 170..200 CDD:285248 18/29 (62%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.