DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EFNB1 and Ephrin

DIOPT Version :9

Sequence 1:NP_004420.1 Gene:EFNB1 / 1947 HGNCID:3226 Length:346 Species:Homo sapiens
Sequence 2:NP_651927.1 Gene:Ephrin / 43799 FlyBaseID:FBgn0040324 Length:652 Species:Drosophila melanogaster


Alignment Length:192 Identity:60/192 - (31%)
Similarity:89/192 - (46%) Gaps:34/192 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    58 DKLDIICPRAEAG---RPYEYYKLYLVRPEQAAACS-TVLDPNVLVTCNRPEQEIRFTIKFQEFS 118
            |::.||||..|.|   ...|.|.:|.|...:...|. |..||.|:..|::|::.:.|||.|:.|:
  Fly   249 DQVHIICPVYEPGTFENETEKYIIYNVSKVEYETCRITNADPRVIAICDKPQKLMFFTITFRPFT 313

Human   119 PNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKV---GQDPNAVTPEQLTTSR 180
            |...||||...:|||..|||  |.:.|..|.||.|.|..||::.||   .:|.|..|  .|:.|:
  Fly   314 PQPGGLEFLPGNDYYFISTS--SKDDLYRRIGGRCSTNNMKVVFKVC
CAPEDNNKTT--ALSNSK 374

Human   181 PSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEK-----SGPGASGG-------SSGDP 230
            ...:....:.:         ::.::|..|  ||....     :..|.:||       |:|.|
  Fly   375 SVTDTGGAINV---------NIANNDESH--VNSHGNNIAIGTNIGINGGQIIGGPQSAGIP 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EFNB1NP_004420.1 Ephrin-B_Ectodomain 31..165 CDD:259897 45/113 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 169..228 12/70 (17%)
Nuclear localization signal. /evidence=ECO:0000269|PubMed:16930449 260..273
Interaction with ZHX2. /evidence=ECO:0000250|UniProtKB:P52795 263..294
PDZ-binding. /evidence=ECO:0000255 344..346
EphrinNP_651927.1 Ephrin_ectodomain 217..358 CDD:259861 44/110 (40%)
PigN <557..>622 CDD:282796
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153162
Domainoid 1 1.000 74 1.000 Domainoid score I9142
eggNOG 1 0.900 - - E1_KOG3858
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001210
OrthoInspector 1 1.000 - - otm40642
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11304
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4391
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.