DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EFNA5 and Ephrin

DIOPT Version :9

Sequence 1:NP_001953.1 Gene:EFNA5 / 1946 HGNCID:3225 Length:228 Species:Homo sapiens
Sequence 2:NP_651927.1 Gene:Ephrin / 43799 FlyBaseID:FBgn0040324 Length:652 Species:Drosophila melanogaster


Alignment Length:230 Identity:64/230 - (27%)
Similarity:101/230 - (43%) Gaps:48/230 - (20%)


- Green bases have known domain annotations that are detailed below.


Human     4 VEMLTLVFL--VLWMCVFSQDPGSKAVADRYAVYWNSSNP--RFQRGDYHIDVCIN--------D 56
            |.:|||:.:  ||...:.|       .|..:.::||:||.  |....|:.|||  |        |
  Fly   194 VTLLTLICMETVLLSTMSS-------CAKTFYMHWNTSNSIFRIDNTDHIIDV--NKGNLAFEFD 249

Human    57 YLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWE-CNRPHSPNGPLKFSEKFQL 120
            .:.:.||.||....|::||:|::|.|:...|..|..|:...:... |::|..   .:.|:..|:.
  Fly   250 QVHIICPVYEPGTFENETEKYIIYNVSKVEYETCRITNADPRVIAICDKPQK---LMFFTITFRP 311

Human   121 FTPFSLGFEFRPGREYFYISSAIPDN------GRRSCLKLKVFVR---------PTNSCMKTIGV 170
            |||...|.||.||.:|::||::..|:      ||.|...:||..:         .|.:...:..|
  Fly   312 FTPQPGGLEFLPGNDYYFISTSSKDDLYRRIGGRCSTNNMKVVFKVCCAPEDNNKTTALSNSKSV 376

Human   171 HDRVFDVNDKVENSLEPADDTVHESAEPSRGENAA 205
            .|....:|..:.|:        .||...|.|.|.|
  Fly   377 TDTGGAINVNIANN--------DESHVNSHGNNIA 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EFNA5NP_001953.1 Ephrin-A_Ectodomain 30..159 CDD:259896 45/145 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..205 5/18 (28%)
EphrinNP_651927.1 Ephrin_ectodomain 217..358 CDD:259861 45/145 (31%)
PigN <557..>622 CDD:282796
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153160
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3858
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11304
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.