Sequence 1: | NP_038861.2 | Gene: | Rax / 19434 | MGIID: | 109632 | Length: | 342 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_726006.3 | Gene: | Rx / 37367 | FlyBaseID: | FBgn0020617 | Length: | 904 | Species: | Drosophila melanogaster |
Alignment Length: | 436 | Identity: | 133/436 - (30%) |
---|---|---|---|
Similarity: | 154/436 - (35%) | Gaps: | 210/436 - (48%) |
- Green bases have known domain annotations that are detailed below.
Mouse 77 PAGGSES----------SPPAAPGFVPEYEATRPCYPKEQGEARPSPGLSVGPAAGDSKLSEEEP 131
Mouse 132 PKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAGKVNLPEVRVQVWFQNRRAKWRRQEK 196
Mouse 197 LEVSSMKLQDSPLLSFSRSPPSSALAPLGTGPGSGSGPPGSALPLEPWLGPPLPGGGATALQSLP 261
Mouse 262 GF--------------------------------------GPP-------GQGLPASYTPPPPFL 281
Mouse 282 NSAP-------------LGPGLQQLGP-----------------------PP-------AYPCAP 303
Mouse 304 AFGDKFSLEEAYP---------------------------------------------------- 316
Mouse 317 -------------------------RNSSIAALRLKAKEHIQAIGK 337 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rax | NP_038861.2 | Octapeptide motif | 33..40 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 44..140 | 19/72 (26%) | |||
Homeobox | 140..192 | CDD:278475 | 50/51 (98%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 208..295 | 34/144 (24%) | |||
OAR | 316..331 | CDD:281777 | 10/91 (11%) | ||
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 | 319..332 | 9/12 (75%) | |||
Nuclear localization signal. /evidence=ECO:0000255 | 325..329 | 2/3 (67%) | |||
Rx | NP_726006.3 | Homeobox | 563..615 | CDD:278475 | 50/51 (98%) |
OAR | 876..892 | CDD:281777 | 9/15 (60%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 119 | 1.000 | Domainoid score | I5818 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D454642at33208 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000011 | |
OrthoInspector | 1 | 1.000 | - | - | oto95173 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_106944 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2565 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
8 | 7.850 |