DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EEF1G and GstD10

DIOPT Version :10

Sequence 1:NP_001395.1 Gene:EEF1G / 1937 HGNCID:3213 Length:437 Species:Homo sapiens
Sequence 2:NP_652713.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster


Alignment Length:151 Identity:37/151 - (24%)
Similarity:69/151 - (45%) Gaps:12/151 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    46 TPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYV-----SNEELRGSTPEAAAQVVQWVSFADSD 105
            |||:|:..|...:|... |.||.::||.||..|:     .:::|.....:..|.:.|.:.|....
  Fly    41 TPEYLKINPQHTIPTLH-DHGFALWESRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGT 104

Human   106 IVPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLW 170
            :....|.:.:|.:.:   .|.|.|...:::......|:.:|:.:|:..|...:||||..:.|:..
  Fly   105 LYKSFSEYYYPQIFL---KKPANEENYKKIEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVST 166

Human   171 LYKQVLEPSFRQAFPNTNRWF 191
            .  .|....|:: :.|..||:
  Fly   167 F--DVAGFDFKR-YANVARWY 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EEF1GNP_001395.1 GST_N_EF1Bgamma 4..82 CDD:239342 14/40 (35%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 22/101 (22%)
tolA <212..>278 CDD:236545
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..268
EF1G 277..381 CDD:459888
GstD10NP_652713.1 GST_N_Delta_Epsilon 1..75 CDD:239343 14/34 (41%)
GST_C_Delta_Epsilon 89..205 CDD:198287 22/102 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.