DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EEF1G and GstD7

DIOPT Version :9

Sequence 1:NP_001395.1 Gene:EEF1G / 1937 HGNCID:3213 Length:437 Species:Homo sapiens
Sequence 2:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster


Alignment Length:218 Identity:58/218 - (26%)
Similarity:91/218 - (41%) Gaps:47/218 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    47 PEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYV------SNEELRGSTPEAAAQVVQWVSFADSD 105
            |||:|..|...:|... |:||.::||.|||.|:      .:..|..:.|:..|.:.|.:.|....
  Fly    44 PEFVRINPQHTIPTLV-DNGFVIWESRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGT 107

Human   106 IVPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITV---VCT 167
            :....:.:.|.   |....|...:.|.::|....|.|:.:|:.:.|:.|.::|:|||.:   |.|
  Fly   108 LYDALTKYFFL---IFRTGKFGDQEALDKVNSAFGFLNTFLEGQDFVAGSQLTVADIVILATVST 169

Human   168 LLWLYKQVLEPSF-RQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTP 231
            :.|.       || ...|||..||..   |.|  :...|..:..|.:.|  .|||.         
  Fly   170 VEWF-------SFDLSKFPNVERWLK---NAP--KVTPGWEQNLESLQQ--GKKFL--------- 211

Human   232 RKEKGSREEKQKPQAERKEEKKA 254
                      |..||.:::|.||
  Fly   212 ----------QDLQAAKEKEVKA 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EEF1GNP_001395.1 GST_N_EF1Bgamma 4..82 CDD:239342 15/40 (38%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 31/125 (25%)
tolA <212..>278 CDD:236545 10/43 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..268 7/34 (21%)
EF1G 277..381 CDD:395522
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 15/33 (45%)
GstA 6..188 CDD:223698 44/154 (29%)
GST_C_Delta_Epsilon 92..206 CDD:198287 31/128 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.